(data stored in ACNUC7421 zone)

EMBL: AP009493.PE654

AP009493.PE654       Location/Qualifiers
FT   CDS_pept        773025..773231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_654"
FT                   /product="putative MbtH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_654"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17483"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR5"
FT                   /protein_id="BAG17483.1"
FT                   /translation="MTNPFDDPDTQHRVLVNDEGQHALWPSFAAVPAGWDEVFGPAGHT
FT                   ACLEYVEAHWTDITPRSARVRVA"
     atgacgaacc ccttcgacga ccccgacacc cagcaccgcg tcctggtcaa cgacgagggc        60
     cagcacgccc tgtggccgtc gttcgcggcg gtcccggccg gctgggacga ggtcttcggc       120
     ccggccgggc acacggcctg cctggagtac gtggaggccc actggaccga catcaccccc       180
     aggagcgccc gcgtgcgggt ggcatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page