(data stored in ACNUC7421 zone)

EMBL: AP009493.PE655

AP009493.PE655       Location/Qualifiers
FT   CDS_pept        773299..774309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_655"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_655"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17484"
FT                   /db_xref="GOA:B1VRR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR6"
FT                   /protein_id="BAG17484.1"
FT                   /translation="MTSPPTRPAIRAEGLTKRFGKKQALNGVDLEAAPGTVLGVLGPNG
FT                   AGKTTAVRVLSTLLRPDGGRAWMAGHDVLAAPEAVRRDLGLSGQYAAVDEKLSGRENLY
FT                   LVARLYGFGRHAARRRAGQLLSDFDLEDAADLPSKTYSGGMRRRLDLAGALVARPPVVV
FT                   LDEPTTGLDPRGRADTWQAVRSLVAEGTTVLLTTQYLEEADQLADAIVVIESGTVVARG
FT                   SAAQLKARVGGERLSLTVAEPRHRSTATEILATLGEHLPDLDQRTGRLTVATDHGARSL
FT                   EYALSRLRLAGIVVQDVGLAPPTLDDVFLSLTGRPIAPDGATASPGVAVVGGGAR"
     atgacctccc caccgacccg cccggccata cgggccgaag gactcaccaa gcgcttcggg        60
     aagaagcagg cgctgaacgg tgtggatctg gaagcggccc ccggcaccgt gctgggggtc       120
     ctcggcccga acggcgcggg caagaccacc gcggtgagag tcctgtccac actgctgcgg       180
     cccgatggcg gccgcgcctg gatggccggt cacgacgtcc tcgccgcccc cgaggccgtg       240
     cgccgtgacc tcggtctttc ggggcagtac gccgcggtgg acgagaagct ctcgggtcgg       300
     gagaacctct acctggtcgc gcggctctac gggttcgggc ggcatgccgc ccgccgcagg       360
     gccggtcaat tgctcagcga cttcgatctg gaggacgcgg ccgacctgcc gagcaagacg       420
     tactcagggg ggatgcgcag acgtctcgac ctggccggcg ccctggtggc gcgaccgccc       480
     gtggtggtgc tggacgagcc cacgaccggg ctcgaccccc gaggccgggc cgacacctgg       540
     caggccgtca ggagtctcgt cgccgagggc accaccgtgc tgctcaccac ccagtacctg       600
     gaggaagcgg accagttggc cgacgccatc gtcgtcatcg agagcggcac ggtggtggcc       660
     cgcggttccg cggcccaact caaggcacgg gtgggcggcg agcggctctc gctcaccgtc       720
     gcggagccac ggcatcgcag caccgccaca gagatcctgg ccacgctcgg cgagcacctc       780
     cccgacctgg accagcgcac cggacgcctg accgtcgcca ccgaccacgg agcacggagc       840
     ctggaatacg ccttgagccg ccttcggctg gcaggaatcg tcgtccagga cgtggggttg       900
     gcgccaccga ccctggacga tgtgttcctc tctctcaccg gccgtcccat cgcgccggac       960
     ggagcaacgg cctctccggg cgtcgcggtc gtcggcggag gtgcgcgatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page