(data stored in ACNUC7421 zone)

EMBL: AP009493.PE656

AP009493.PE656       Location/Qualifiers
FT   CDS_pept        774306..775106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_656"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_656"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17485"
FT                   /db_xref="GOA:B1VRR7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR7"
FT                   /protein_id="BAG17485.1"
FT                   /translation="MTAVQRLGRDSSIIAWRNLLNLRRTPGSVIAALVQPVMFVLLLAY
FT                   VFGGSLGGAEYRTFLMGGIFAQAVTFNSAFTALGLANDMDKGIVDRFRSLPMPAMAVLL
FT                   GRTLSDLTMSAVTLVVTSLCGLLVGWRISASPAEALAAYLLILLFAFAMSWVGAAIGLM
FT                   ARSVEVAQSAGLIWLFPVTFVSAAFVSPHTMPGPLRTVAEWNPVSATATAVRGLFGNPP
FT                   PSGLPTSDAWPVVHALPYSAACAIVITGVFMLLALIRFRRITLG"
     atgacagcgg tccagcggct gggccgcgac tcctcgatca tcgcctggcg caatctcttg        60
     aacctgcgcc ggacccccgg gtcggtcatc gcggcgctcg tgcagccggt gatgttcgtc       120
     ctgctgctcg cctacgtctt cggtggcagc cttggcgggg ccgaataccg gacgttcctc       180
     atgggtggca tcttcgccca ggccgtcacc ttcaactccg ccttcaccgc actcggactg       240
     gccaacgaca tggacaaggg catcgtggac cgcttccgct ccctccccat gcccgccatg       300
     gccgtgctcc tggggcggac tctgtccgac ctgaccatga gcgcggtgac cctggtcgtc       360
     acctccctgt gcggcctgct ggtcggctgg cgcatcagcg cctcacccgc cgaggccctc       420
     gcggcttacc tgctgatcct gctcttcgcc ttcgccatgt cctgggtggg ggccgcgatc       480
     ggactgatgg cccgcagcgt cgaggtcgcc cagagcgcgg ggctgatatg gctgttcccg       540
     gtcactttcg tctccgccgc cttcgtgtcc ccgcacacca tgcccggccc gctgcgcacc       600
     gtggcggagt ggaaccccgt ctccgccacg gccaccgcgg tccgcggact cttcggcaac       660
     ccgccgccca gcggcctgcc caccagcgac gcctggcccg tcgtgcacgc gctcccctac       720
     tccgcggcct gtgccatcgt catcaccggc gtgttcatgc tcctcgcgct gatccgcttc       780
     cggcgcatca ctctcggatg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page