(data stored in ACNUC7421 zone)

EMBL: AP009493.PE658

AP009493.PE658       Location/Qualifiers
FT   CDS_pept        776630..776995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_658"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17487"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR9"
FT                   /protein_id="BAG17487.1"
FT                   /translation="MSETETYYEFGTAADRWDRAQMFFEAKEYLTAARILGGLVGEAPE
FT                   QVAPRLLLARSYYHSARLVKAEQELRVVLELDPVESYAHLMLGRTLERQGRGADAAPHL
FT                   RIAAALTGDFGPGDTGS"
     gtgagcgaga ccgagaccta ctacgagttc ggcaccgccg ccgaccggtg ggaccgggcg        60
     cagatgttct tcgaggccaa ggagtacctg acggcggcac ggatcctggg cggactcgtc       120
     ggggaagcgc cggagcaggt cgcgccgcgg ctgctgctgg cccgctccta ctaccactcc       180
     gcccggctgg tcaaggcgga gcaggagctc cgggtcgtcc tggagctcga cccggtggag       240
     agctacgcac acctgatgct gggccggacg ctggagcgcc aggggcgggg cgccgacgcg       300
     gcgccgcacc tgcggatcgc cgccgccctc accggcgact tcggccccgg agacacgggc       360
     tcctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page