(data stored in ACNUC7421 zone)

EMBL: AP009493.PE662

AP009493.PE662       Location/Qualifiers
FT   CDS_pept        complement(779715..780470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_662"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17491"
FT                   /db_xref="GOA:B1VRS3"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRS3"
FT                   /protein_id="BAG17491.1"
FT                   /translation="MNSISVRALLVRGMLAGLIAGAFALAVAYFLGESQVDAAIALEEA
FT                   HSHDHGGGEELVSRTMQATGGLATGVLVFGVAVGGIAALVFCYALGRIGGFGPRATAAL
FT                   IAGAALLTVYVVPFLKYPANPPAVGNPDTIGERTALFFLMVALSVLLAVAAVIIGRRLA
FT                   SRLGNWNATVASAAGFILLIGLAYAFLPSFDEVGKDFPAGLLWEFRLSTLAVQVTLWSV
FT                   FGVVFGHLTERLLSPPARVATPRAASAVN"
     gtgaactcca tatctgtcag agctctgctc gtgcgcggca tgctcgcggg cctcatcgcg        60
     ggcgcgttcg cgctcgccgt ggcctacttc ctcggtgagt cccaggtgga cgcggccatc       120
     gccctcgaag aggcccacag ccacgaccac ggcggcggcg aggagttggt gagccgcacc       180
     atgcaggcca ccggcggact cgccaccggt gtactggtct tcggcgtcgc cgtgggcggg       240
     atcgccgccc tcgtgttctg ctacgcgctg ggccgcatcg gcggcttcgg cccccgggcc       300
     accgcggcgt tgatcgcggg cgccgccctg ctcacggtct acgtggtgcc gttcctcaag       360
     tacccggcga atccacccgc cgtcggcaac cccgacacca tcggcgagcg caccgccctg       420
     ttcttcctga tggtcgccct cagcgtgctg ctggccgtcg ccgccgtcat catcggcagg       480
     cggctcgcgt cccgcctggg caactggaac gcgaccgtgg cgtccgccgc cggcttcatc       540
     ctgctgatcg gtctcgccta cgccttcctg ccctccttcg acgaggtggg caaggacttc       600
     ccggccggtc tgctgtggga gttccggctc tccacgctcg cggtacaggt gacgctgtgg       660
     agcgtcttcg gcgtcgtctt cgggcacctc accgaacggc tcctgtcgcc gcccgcccgg       720
     gtcgcgacgc cccgggccgc gagtgcggtg aactga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page