(data stored in ACNUC7421 zone)

EMBL: AP009493.PE667

AP009493.PE667       Location/Qualifiers
FT   CDS_pept        complement(783636..785855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_667"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17496"
FT                   /db_xref="GOA:B1VRS8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRS8"
FT                   /protein_id="BAG17496.1"
FT                   /translation="MSAEPTGNPFGPTRGPLSPRRSRRAVPVLAFLLAVLCVTTVALTA
FT                   TVRSTVASPGFYQAVLDEESAYDRLYGEVLVDPEISPVTRDLLAHLPVPEALVTSNIKV
FT                   VLPPATVRALTDQQIEAVTGYLRGDRDELRLTVDLAPVLENLADLARVYFGDLVAGIQG
FT                   SDQPDFDRFTADLATALDALKQGRAPNLPTLPLTEDQADRAADALLTTVPERERAALRP
FT                   EIEVALGEGDVSTALAATAAAALSDGSRTAAAGLRTILQGGTWDLTGTLTAAGADVTAL
FT                   ERARDTIRLLTLLQVLALTVALAALATLWFTGPAAPARRLMRLGQALACAGGLTAAAVL
FT                   LARLITGGRLLAVPSSWAPSVAALVDDLQRNAVNQVVATGLSAALTALVGGVLLTGAGW
FT                   ALLVRPGRMPTPTPTAVRTTAAGVACAALAGVLLAPPVFGPSAPRQCLGSSRLCELRYD
FT                   EAAYLTAHNAMSTTADRFIGPLQDPDITTQLDTGVRALQLDTYRWESPQDIAGRLDSPE
FT                   FTPEQRRLITGAIDLANPPREGLWLCHGVCRAGAVELVPALEDIGDWLRSHPTEIVTLI
FT                   VQDDISPEDTEEAFRTAGLEDLLHTPAADPDAPWPTLGEMIDSGRRLVVFAEKADGPAP
FT                   WYRNFYRYGMETPFAFRSPSEMTCEPHRGGTGKQLFLLNHFITNAGGSRLDAGRVNARD
FT                   WVLERTRACEAERGSPVTFIAVDYTTVGDALGAVNELNSTRSERD"
     gtgagtgccg aaccgaccgg gaacccgttc gggccgaccc ggggacccct gtccccgcgc        60
     cggtcccgcc gtgccgtgcc ggtgctcgcc ttcctgctgg ccgtcctgtg cgtgacgacg       120
     gtcgccctga ccgcgaccgt ccggtccacg gtcgcctcgc caggcttcta ccaggcggtg       180
     ctggacgagg aatcggccta cgaccggctc tacggcgaag tgctcgtcga cccggagatc       240
     tcgcccgtca cccgcgacct gctcgcccac ctgcctgtcc ccgaggcgct ggtgacgtcg       300
     aacatcaagg tcgtcctgcc gcccgccacg gtccgggccc tcaccgacca gcagatcgag       360
     gcggtgaccg gctatctgcg cggcgaccgc gacgaactcc ggctgaccgt cgacctggcc       420
     ccggtgctgg agaacctcgc cgacctcgca cgcgtctact tcggcgacct ggtggccggt       480
     atccagggga gcgaccagcc ggacttcgac cgcttcaccg ccgacctcgc gacagcgctc       540
     gacgcgctca agcagggccg ggcgccgaac ctgcccacgc tgccgctcac cgaggaccag       600
     gccgaccgcg ccgccgacgc cctcctcacg acggttccgg agcgcgagcg ggcggcgctg       660
     cgccccgaga tcgaggtggc cctgggggag ggggacgtgt ccaccgcgct ggcggccacc       720
     gcggccgccg cgctctcgga cggatcgcgg acggccgccg ccggcctccg taccatcctc       780
     cagggcggta cgtgggacct caccggcacc ctgaccgccg ccggggcgga cgtcacggcc       840
     ctggaacggg cccgtgacac catccggctc ctgaccctgc tccaggtcct cgccctcacc       900
     gtcgccctgg ccgcgctcgc gacgctctgg ttcaccggtc ccgccgcccc cgcccgccgg       960
     ctgatgcgcc tggggcaggc gctcgcctgc gcggggggcc tgaccgccgc ggccgttctc      1020
     ctggcccggc tgatcaccgg aggacgcctc ctcgccgtcc cctcctcctg ggccccgagc      1080
     gtcgccgcgc tcgtcgacga cctccagcgc aacgccgtga accaggtggt cgccaccggg      1140
     ctgagcgccg ccctcacggc cctcgtcggc ggcgtgctcc tcacgggcgc cggctgggcg      1200
     ctcctggtgc gcccgggacg gatgcccacc ccgaccccga cagcggtgcg gacgacggcg      1260
     gccggcgtgg cctgtgccgc actggccggc gtcctgctcg cgccgcccgt gttcggcccg      1320
     tccgcacccc gccagtgcct gggcagcagc cgcctgtgcg aactgcgcta cgacgaagcc      1380
     gcctacctca ccgcgcacaa cgccatgtcc accaccgccg accggttcat cggccccctc      1440
     caggaccccg acatcaccac ccagctcgac acgggggtcc gggccctcca actcgacacg      1500
     taccgctggg agagccccca ggacatcgcc gggcgcctcg actcccccga gttcaccccc      1560
     gagcagcggc gcctgatcac cggcgccatc gacctggcca acccgccgcg cgagggcctg      1620
     tggctctgcc acggcgtctg ccgcgccggg gccgtcgaac tggtcccggc cctggaggac      1680
     atcggcgact ggctgcgctc ccaccccacc gagatcgtga ccctcatcgt ccaggacgac      1740
     atcagccccg aggacaccga ggaggcgttc cgcaccgccg gcctggagga cctgctgcac      1800
     acccccgcgg cggatcccga cgccccgtgg cccaccctgg gcgagatgat cgacagcggc      1860
     cggcgactgg tggtgttcgc cgagaaggcc gacggccctg cgccctggta ccgcaacttc      1920
     taccggtacg gaatggagac cccgttcgcc ttccgcagcc cctccgagat gacgtgcgaa      1980
     ccccaccggg gcggcaccgg gaaacagctt ttcctgctga accacttcat cacgaacgcg      2040
     ggcggcagcc gcctggacgc cggccgcgtc aacgcccgcg actgggtcct cgaacggacc      2100
     cgcgcctgcg aggcggaacg cggcagtccg gtcaccttca tcgccgtcga ctacacgacg      2160
     gtcggcgacg cgctcggcgc ggtgaacgaa ctgaactcca cccgatcaga acgtgattga      2220
//

If you have problems or comments...

PBIL Back to PBIL home page