(data stored in ACNUC7421 zone)

EMBL: AP009493.PE673

AP009493.PE673       Location/Qualifiers
FT   CDS_pept        complement(791859..792830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_673"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_673"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17502"
FT                   /db_xref="GOA:B1VRT4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT4"
FT                   /protein_id="BAG17502.1"
FT                   /translation="MTSRPNIRTAALTGLAPAVWGSTYLVATELLPPDRPLLATTVRAL
FT                   PGGLVLLALGRRLPAGVWWWRAPVLGVLNIGAFNFLLFLAAYRLPGGIAAVIMSAQPMF
FT                   VVVLAALFLGERIRALHALACVMGAGGVALLVLRGAAPLDALGVLAAVGGALCMGLGIT
FT                   LTKRWGRPEGVGLLTFTGWQLTAGGLVLLPFWLSLEGLPDSLTGSNVLGFAHLITLGAV
FT                   LSYFVWFRGIERLPAVAVSFLALGSPVVATLLGYLVRGETLSVLQLVGMAVILGAVVLG
FT                   QRPPPVPAAGPEPARRNLHEPHPARSGETVREGGRPGGRTRP"
     atgacgagca gaccgaacat acgcacagcc gccctgaccg gtctcgctcc ggcggtctgg        60
     ggcagcacct acctggtcgc caccgagctg ttgccaccgg accggccact cctggcgacc       120
     accgtccggg ccctgcccgg tggcctggtc ctgctggccc tcggccgtcg gctccccgcc       180
     ggcgtctggt ggtggcgggc gccggtcctg ggcgtgctga acatcggcgc cttcaacttt       240
     cttctcttcc tcgccgccta tcggctgccg ggcggtatcg ccgccgtgat catgtcggcc       300
     cagcccatgt tcgtcgtggt cctcgccgcc ctcttcctcg gtgaaaggat cagagccctg       360
     cacgccctgg cctgcgtcat gggcgccggg ggagtggcgc tgctcgtgct caggggtgcg       420
     gcaccgctcg acgccctcgg tgtcctcgcg gccgtcggcg gtgcgctgtg catgggcctg       480
     ggcatcaccc tgaccaaacg gtggggccgg ccggaaggcg tcggcctgct cactttcacc       540
     gggtggcaac tcacggcggg cggcctggtc ctgctgccgt tctggctgtc gctggaaggg       600
     ctcccggaca gcctcaccgg atccaacgtc ctcgggttcg cccacctcat cacgctgggc       660
     gcggtcctga gctacttcgt ctggttccgg ggcatcgagc gcctgcccgc cgtcgccgtc       720
     tccttcctgg cgctgggcag tccggtcgtg gcgaccctgc tgggctacct ggtcaggggc       780
     gagacgctgt ccgtcctcca gctcgtcggc atggccgtga tcctcggtgc ggtcgtgctc       840
     ggccagcgcc cgcccccggt cccggccgcc gggccggaac cggcccggcg gaacctccac       900
     gaaccacacc cggcccggtc cggagagacc gttcgcgagg gcggccggcc cggcgggcgt       960
     acacggcctt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page