(data stored in ACNUC7421 zone)

EMBL: AP009493.PE676

AP009493.PE676       Location/Qualifiers
FT   CDS_pept        795069..795584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_676"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17505"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT7"
FT                   /protein_id="BAG17505.1"
FT                   /translation="MTMACGRPAGDRPSCADLTTQQSRTCDIRPGGSLDSCTMRGMPEY
FT                   LELDLGGAALRVELAAVGEPAPLPASTAAPDDVDLPDGFGTATPVARGRRAAEVAQDVL
FT                   KSALSPLGPLLEEVHAAVTGTAHPPQELTVEFGVQIGQDLKLGIVGVNGQATMTVSASW
FT                   QNKGPGEA"
     gtgacgatgg cgtgcggccg gcccgccggg gaccggccct cctgcgcgga cctaaccacc        60
     cagcagtccc gaacttgtga catccgaccc ggcgggtccc tcgattcatg cacaatgcga       120
     ggcatgccgg aataccttga actcgacctc ggcggagccg cgttacgcgt ggagctggct       180
     gccgtcgggg aaccagcgcc gctccccgcc tcgacggccg ccccggacga cgtcgacctt       240
     cccgacggct tcggaacggc cacccccgtg gccaggggac gacgcgccgc agaggtggcg       300
     caggacgtgc tgaagtccgc tctcagccct ctcggtccgc tcctcgagga ggttcacgca       360
     gcggtcaccg gcaccgcgca tccgccccag gaactcacgg tcgagttcgg tgtccagatc       420
     ggccaggacc tcaagctcgg gatcgtgggg gtgaacggcc aggcgaccat gacggtgagt       480
     gccagctggc agaacaaggg acccggcgag gcctag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page