(data stored in ACNUC7421 zone)

EMBL: AP009493.PE677

AP009493.PE677       Location/Qualifiers
FT   CDS_pept        795586..797802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_677"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17506"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT8"
FT                   /protein_id="BAG17506.1"
FT                   /translation="MGWFSRRSAPGSHTALLRTSDSRAAGGAVLLSTRRILTCAHVVND
FT                   ALGRALLSTEHPEHGGAFAVSFRGADAAAGVGTGRVSLWLPPQQRAGSPVWGGDLAVLD
FT                   LDEPAPDWTRPVVWQDMLEGMELRAWHGGGAAITYANTVAGLQHDGCCYLDGSLSGAAI
FT                   GPGYSGGPLWVRSDATVAGLAVAQVMSDGPALKAQDTVRRGWAVPWQTIREEMTRAGAG
FT                   DVVAECQVVRRGRATGPAETSVQAMAPLLRTLLDDPVRRTDHCRDLSFALECDVPTGGA
FT                   QAPTLDEVATVLLTEDRALATLSESLAPAVEHDPPRRRALSALLALGRVEDHVRLLSFA
FT                   EHRQLVGFLQTSVRTDPGLIARAAREALRFMNLPIVLSQASRPTVADVDAIILDLEDYP
FT                   DGGLTTAQSVPVPALLRLTEFAAAATADTTHRARLRAWCDRVADRLDISPPALAERRAD
FT                   AETWAAHRPSPVTRVGTRLTPADGEPAGRFRCEIWLWHRDGTRVGVTTPKAFLTPEEIG
FT                   RLLRRTAEGSRAAGEPAPTQVDVVVGPAHLEIDVDGWETGSELADGLPELSGLRDVLPD
FT                   VSGLSVALGSRYQVALRCPDFTVRTADEVQRRWAADTPHSLVVGDPSVDIQHLYELLST
FT                   THRDTVRVVLHGPPQQRSRLLPVCLAMGVPVVLWDRAATSHDDAPRLDHLDPTGPLDKL
FT                   PQRLQNLRSAIYGAEAGLSTARPALVWHDTELSLPEPLQFADPA"
     atgggctggt tcagccgccg ttcagcgccc ggctcccaca ccgcactgct gcgcacgagt        60
     gactccaggg ccgcgggcgg cgcggtcctt ctctccaccc gtcgcatcct cacctgcgcc       120
     cacgtcgtca acgacgccct gggtcgcgcc ctgctgagca ccgaacaccc cgagcacggc       180
     ggggcgttcg ccgtctcctt ccggggcgcc gatgcggcgg ccggtgtggg gaccggccgt       240
     gtctcgctgt ggctgccgcc ccagcagcgg gccggcagcc ccgtgtgggg tggtgacctg       300
     gcggtgctgg atctcgacga acccgccccc gactggacca ggcccgtcgt ctggcaggac       360
     atgctggagg gcatggagct gcgggcctgg cacggcggcg gcgccgcgat cacctacgcg       420
     aacaccgtcg cgggcctcca gcacgacggc tgctgctact tggacgggtc cctgtccggg       480
     gccgcgatcg gccccggata cagcggtggt cccctgtggg tcagatccga tgccacggtc       540
     gccgggctcg ccgtcgcgca ggtgatgtcg gacgggcctg ccctcaaggc ccaggacacc       600
     gtgcgtcggg gctgggccgt gccctggcag accatacggg aggagatgac gcgggcgggg       660
     gccggtgacg tcgtcgcgga gtgccaggtg gtgcggcggg gccgcgccac gggccccgcc       720
     gagacctccg tacaggcgat ggcgcccctg ttgcgcaccc tgctggacga cccggtgcgg       780
     cggaccgacc actgccgcga cctctcgttc gccctggagt gtgacgtacc gacgggcggg       840
     gcacaggcgc ccaccctcga cgaggtggcg accgtcctgc tcacggagga ccgggcgctc       900
     gccacgctgt ccgagtcgct ggccccggcc gtcgagcacg accctccccg gcgccgcgcg       960
     ctgagcgccc tgctggcact gggccgcgtc gaggaccatg tccggctgct ctccttcgcc      1020
     gaacaccgtc aactcgtcgg attcctgcag acgagcgtcc ggaccgaccc cggtctgatc      1080
     gcccgcgccg cccgtgaggc cctccggttc atgaacctgc cgatcgtgct ctcacaggcc      1140
     tcccggccca cggtggcaga cgtcgacgcg atcatcctcg acctggagga ctaccccgac      1200
     ggcggtctca cgaccgccca gtccgtcccg gttcccgcac tgctcagact gaccgagttc      1260
     gccgccgcgg ccaccgccga caccacgcat cgcgcccgtc tgcgcgcgtg gtgcgaccgt      1320
     gtcgccgacc gactggacat cagccccccg gccctggcgg aacggcgggc cgacgccgag      1380
     acgtgggccg cccaccggcc gtcgcccgtc acccgcgtcg gcacccgcct caccccggcg      1440
     gacggcgaac cggccggccg cttccgctgc gagatctggc tctggcacag ggacggcaca      1500
     cgcgtgggcg tcaccacccc caaggccttc ctgacgcccg aggagatcgg caggctgctg      1560
     cgccgcaccg cggaaggcag ccgcgcggcg ggcgagccgg cccccaccca ggtggacgtg      1620
     gtcgtcggcc cggcccatct cgagatcgac gtcgacggct gggagacggg cagcgaactg      1680
     gcggacggcc tccccgaact ctccgggctc agggacgtcc tccccgatgt cagcggtctc      1740
     agcgtggccc tgggcagtcg ctaccaagtc gccctccggt gccccgattt caccgtcagg      1800
     accgctgatg aggtccagcg ccgctgggct gccgacacac cgcattcgct ggtggtcggc      1860
     gacccttccg tcgacatcca gcacctgtac gaactgctga gcaccaccca ccgcgacacc      1920
     gtccgggtcg tcctgcacgg cccgccgcag cagcggagcc gtctgctgcc ggtctgcctg      1980
     gcgatgggcg tgcccgtcgt cctgtgggac cgggcggcca cgtcgcacga cgacgccccc      2040
     cggctcgacc acctcgatcc gaccggcccg ctggacaagc tcccgcagcg gctgcagaac      2100
     ctccgttccg ccatctacgg agcggaggcg ggtctgtcga ccgcgagacc ggccctcgta      2160
     tggcacgaca ccgagctgtc gctgcccgag cccctgcagt tcgcggaccc ggcatga         2217
//

If you have problems or comments...

PBIL Back to PBIL home page