(data stored in ACNUC7421 zone)

EMBL: AP009493.PE678

AP009493.PE678       Location/Qualifiers
FT   CDS_pept        797876..798895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_678"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17507"
FT                   /db_xref="GOA:B1VRT9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT9"
FT                   /protein_id="BAG17507.1"
FT                   /translation="MTAQAPQGHHGAADSRQDSDWRLFKGNGRARQVSFPEAPPWRRFG
FT                   DKEARSRRTRPYLIGPQEADVVNAALLLRRPLLVTGHPGTGKSSLAHALAHELSLGHVL
FT                   HWPVNSRTTLQDALYRYDAIGRLRETNRRRNARDDENAPQEDPGIGSYVRLGPLGTALV
FT                   PSASPRVLLVDELDKGDVDLPNDLLNVFEEGEFEIPELARLTEEQSAVSVMTADSDVWT
FT                   DVVRGRIRCTEFPVVIITSNGERDFPPAFLRRCVRLDLPEPDEERLRAIISAHLDPDGE
FT                   EGGTDGFDDLMRAFLARRARGELATDQLLNAVFLRRGGVELDAEGLLDAVLHRLGRTL"
     atgacggccc aggcacctca agggcaccac ggagcggccg acagccggca ggactccgac        60
     tggcgactgt tcaagggcaa cggccgggcc cgccaggtct ccttccccga ggcaccgccg       120
     tggaggcgct tcggggacaa ggaggcccgc tcccggcgga cccggcccta cctgatcggc       180
     ccgcaggagg ccgatgtcgt caacgccgcc ctgctcctgc gcaggccact gctggtcacc       240
     gggcacccgg ggacgggcaa gtcctccctc gcacacgccc tcgcccatga gctgtccctg       300
     ggccacgtcc tgcactggcc ggtcaacagc cgcaccaccc tccaggacgc gctctaccgc       360
     tacgacgcga tcggccgcct ccgcgaaacg aacagacgcc gcaacgcacg ggacgacgag       420
     aacgcgccgc aggaagatcc cggcatcggc tcctacgtac gtctcggtcc tctcggcacg       480
     gcgctggtgc cgtcggcttc gccacgggtc ctcctcgtgg acgagctgga caagggcgac       540
     gtcgacctgc cgaacgacct gctcaacgtc ttcgaggagg gcgagttcga gatcccggag       600
     ctggcacggc tcaccgagga gcagtccgcc gtgagcgtca tgacggccga ctccgacgtc       660
     tggacggacg tcgtccgcgg gcgtatccgc tgcaccgagt tccccgtggt catcatcacg       720
     agcaacggcg aacgcgactt tccccccgcc ttcctgcgcc gctgcgtgcg tctggacctt       780
     ccggaaccgg acgaggagcg gctgcgcgcc atcatctccg cccacctgga cccggacggc       840
     gaggaaggcg gtactgacgg gttcgacgac ctgatgcgcg cgttcctcgc ccgcagggcc       900
     cgcggtgaac tggccacgga ccagctgctc aacgccgtct tcctgcgccg cggaggtgtc       960
     gaactggacg ccgagggttt gctggacgcc gtactgcacc gcctcggcag aaccctgtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page