(data stored in ACNUC7421 zone)

EMBL: AP009493.PE679

AP009493.PE679       Location/Qualifiers
FT   CDS_pept        798892..802104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_679"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17508"
FT                   /db_xref="GOA:B1VRU0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU0"
FT                   /protein_id="BAG17508.1"
FT                   /translation="MTGRPELGRIRRALAADGEPLDAEELLDVLWLAARLPPSAATALA
FT                   RAAALAEPPAVDPAHRDADGSTPFAPPSPGHDAPDLATADTEPGPVLRPAGETGLHAAP
FT                   LVRQPPARSDRPAMAVRAPGVKALGGAELRLGRALRPLKQMRPDFLRSELDINATVTAM
FT                   AETGLPEAVLRPATTRWLDLTVLVDDGVSMLLWQGLAGELRRLLERCGAFRQVRVHGLG
FT                   TRGPTGPRLRSRPYGASAATLPLSAVLDPAGNTLLLVVSDGVGRSWRDGSMHEALLRAA
FT                   SAGPTAVVHTLPRRLWAGTGIGARSWRVTARRRGAANRSWHIEDPLLPPELAPFDGVPV
FT                   PVLATDGDVIGTWAQLIGSPGETAVLPLLTPPPGTVTAPPPPGSPRRDRTVGAREAVSR
FT                   FRDSASTDAYRLAAHLASVAPLPVPVMRIVQHAVAPAVDTSHLVEVFLGGLMHSADEVE
FT                   RPPHQRAFDFTEETRQILLGTVPPAELMRTTRRVTAHLSELGGSPADFPAWLPHPGGED
FT                   RVSADSRKPFGWVGETLLRRLGVSPPDVSEYETPLSPDDELRPLPPGPTLALHTTRWRR
FT                   LTVSDQRFEGRWALPYDVFAEYGPVESGVFLAHDGEGRLLVIRRPGDEPDAHALIATEV
FT                   LALQRMNGSCSPLLMAWEPDHERPWHAVLCALDDPTQPAPDLHDFTVQHGLLHHAGLLT
FT                   VARQLATGLARAHELGLVHGALTSGRVLIAGRDAQILGWLTASVDGMDSRYWSVHRQHP
FT                   RYRAPELNDATEGPTREADVYALGCVLVEAAVGQGYHGSPSDALEAAREALEPAFIGIL
FT                   RACLHDDPARRPPALQLRRALDSLAGQETDPFTVALGFDADLDSVRLDLRGEPGGGDGP
FT                   HLLCQGRPAQVRRDLLLGVLEQISRQAGRGVAFVLADFDHRSGFDRFARRPGDVSFLGL
FT                   RQGGTDVLALGDLLRRELRRREAPDARGAYGQDRPPLLVVAMDDFPRVHRLAPELHTVL
FT                   REVARAGGRLDIHLIMSADHMDLVATDNAFVSRCARVDLLSRTAEDGSLALDGAVLHIH
FT                   SEVGPVYFTTGHESAVAADRHR"
     gtgaccggcc gccccgagct cgggcggatc cgcagggccc tggcggcgga cggggagccg        60
     ctcgacgccg aggaactcct cgacgtcctc tggctggccg cacggctgcc cccgtccgcc       120
     gccacggccc tcgcgcgcgc cgcggccctc gccgaaccac cggccgtgga tcccgcccac       180
     cgggacgccg acgggtccac cccgttcgct cccccgtcgc cggggcacga cgcaccggac       240
     ctggcgacgg cggacaccga gcccggcccc gtccttcggc cggcggggga gaccggcctg       300
     cacgccgcgc ctctcgtgcg gcagcccccc gcccgttccg accgaccggc gatggccgta       360
     cgggctcccg gtgtcaaggc gctcgggggc gcggagctcc gcctgggacg ggccctgcgt       420
     cccttgaaac agatgcgccc cgacttcctg cgcagcgaac tcgacatcaa cgcgacggtc       480
     acggccatgg cggagacggg gctcccggaa gccgtgctcc gcccggcgac gacgcgatgg       540
     ctcgacctca ccgtcctcgt cgacgacggc gtctcgatgc tcctctggca ggggctcgcc       600
     ggtgaactcc gacggctgct ggaacgctgc ggcgccttcc ggcaggtgcg cgtccacggc       660
     ctgggcaccc gcggccccac cggccctcgg ctgcgcagcc gcccctacgg ggcctccgcg       720
     gcgacgctgc ccctgtccgc ggtgctcgac ccggccggca acacgctgct gctcgtcgtg       780
     agtgacggcg tcggcaggtc ctggcgggac ggttccatgc acgaggcgct gctgcgcgcc       840
     gcgtcggccg ggcccacggc ggtggtgcac acgctgcccc ggcggctgtg ggccgggacg       900
     ggcatcggcg cacggtcgtg gcgggtgacg gctcggcggc gcggcgcggc caaccggtcc       960
     tggcacatcg aggacccgtt gctgcccccc gaactcgccc ccttcgacgg ggttcccgtc      1020
     ccggtgctcg ccaccgacgg cgacgtcatc ggcacgtggg cccagctgat cggctccccg      1080
     ggggagaccg cggtactgcc gctgctcacc ccgccgccgg gcacggtcac cgctccgcca      1140
     ccgcccggtt cgccgcgtcg cgaccgtacg gtcggcgcgc gggaagccgt gtcgcgcttc      1200
     cgtgactccg cgtccacgga cgcctatcgc ctcgccgcgc acctggcctc cgtcgcaccg      1260
     cttcccgtac cggtcatgcg gatcgtccag cacgcggtgg ctccggccgt cgacacgtcc      1320
     cacctggtgg aggtgtttct cggcggactc atgcacagtg ccgacgaggt ggaacggccg      1380
     ccccaccagc gggcgttcga cttcacggag gagacccggc agattctgct cggtaccgtg      1440
     ccgcccgccg aactgatgcg caccacgcgg agggtgacgg cccacctcag cgagctcggc      1500
     ggctctccgg ccgacttccc ggcctggctg ccgcacccgg ggggcgagga ccgggtgtcc      1560
     gccgactcac gaaagccgtt cggctgggtg ggcgagaccc tcctgcgccg gctcggggtc      1620
     tcgccgcctg acgtgtccga gtacgagact ccgctgtccc cggacgacga actgcggccg      1680
     ctgccgcccg ggccgacgct cgccctgcac acgacgcggt ggcgccggct cacggtctcg      1740
     gaccagcggt tcgagggcag gtgggccctg ccctacgacg tcttcgccga gtacggaccg      1800
     gtcgagagcg gtgtcttcct cgcccacgac ggggaggggc gcctgctggt catccggaga      1860
     ccgggcgacg agccggacgc gcacgccctg atagcgacgg aagtgctcgc acttcagcgt      1920
     atgaacggct cctgctcacc gcttctgatg gcatgggagc ccgaccacga gcgaccgtgg      1980
     cacgccgtcc tgtgcgccct ggacgatccg acgcaacccg cacccgacct gcacgacttc      2040
     accgttcagc acgggcttct gcaccatgcg ggcctgctca cggtcgcccg tcagctcgcg      2100
     acaggtctgg cccgggccca cgagctgggt ctggtccatg gggccctgac gtccggcagg      2160
     gtgctgatag cggggcgcga cgcgcagatc ctggggtggt tgaccgcctc ggtggacggt      2220
     atggacagtc ggtactggtc cgtccaccgc cagcacccgc gataccgggc cccggaactg      2280
     aacgacgcca cggaggggcc gacccgggag gccgacgtct acgctctcgg gtgcgtcctc      2340
     gtggaggccg cggtcggcca gggctaccac gggagcccgt ccgacgcgct ggaggcggcc      2400
     agagaggcgc tggaacccgc cttcatcggc atcctccgag cctgcctcca tgacgacccc      2460
     gcccgcagac cccccgcact ccagctgcgc cgggctctcg attccctggc gggtcaggag      2520
     accgatccgt tcacggtcgc cctcggtttc gacgccgatc tggactccgt acggctcgac      2580
     ctgcgcggcg aacccggcgg tggcgacggc ccccatctgc tgtgccaggg acgtccggcg      2640
     caggtccgca gggacctgtt gctgggtgtg ctggagcaga tctcgcgtca ggcgggcagg      2700
     ggggtggcgt tcgtcctcgc cgacttcgac caccgcagcg ggttcgaccg gttcgcgcgg      2760
     cgtccgggcg acgtctcctt cctcggcctc cgccagggtg ggacggacgt gctggcgttg      2820
     ggggatctgc tgcggaggga gttgaggcgc cgcgaggccc cggatgcccg cggggcctac      2880
     ggacaggacc gcccgcctct tctggtcgtg gccatggacg acttcccccg ggtccaccgc      2940
     ctggcacccg aactgcacac cgtcctgcgc gaggtggcca gggccggcgg gcggctcgac      3000
     atccatctga tcatgtccgc cgatcacatg gacctggtgg ccaccgacaa cgccttcgtc      3060
     agccgttgtg cccgcgtcga cctgctgagc cggaccgccg aggacggatc tctggcgctg      3120
     gacggggccg tactccacat ccactccgaa gtgggacctg tgtacttcac cacggggcac      3180
     gagtcggccg tcgcggcgga tcggcacagg tga                                   3213
//

If you have problems or comments...

PBIL Back to PBIL home page