(data stored in ACNUC7421 zone)

EMBL: AP009493.PE68

AP009493.PE68        Location/Qualifiers
FT   CDS_pept        complement(70095..70469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_68t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_68t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16897"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ6"
FT                   /protein_id="BAG16897.1"
FT                   /translation="MAVDEDQPFQAKEIPRGKEFHGSVPAFSLSVKEQVRHHVTPEQGL
FT                   KGLKLRVTTRLRGATGIGRATVRLFAEQGETVIVTGRRPGPLHELAAESGVRTLVCDHT
FT                   DPRALTSPSCRSCRTGSTSL"
     ttggccgtcg acgaggatca gcccttccag gccaaggaga tcccgagggg caaggagttc        60
     cacggttcgg tccctgcgtt cagtctctcc gtgaaagagc aggtcaggca ccatgtaacc       120
     ccggaacagg gactgaaggg actcaagttg agggttacca cgcgactacg tggcgcaacg       180
     ggcattggcc gggcgaccgt ccggctcttc gcggagcagg gcgagacagt gatcgtcacc       240
     ggtcgccgcc ccggtccgct ccatgaactg gcagcggagt ccggcgtccg cacgctggta       300
     tgcgaccaca ctgacccccg ggcgctcacg tcgccctcct gccggagctg ccggaccgga       360
     tcgacgtcct tgtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page