(data stored in ACNUC7421 zone)

EMBL: AP009493.PE680

AP009493.PE680       Location/Qualifiers
FT   CDS_pept        complement(802269..804185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_680"
FT                   /product="putative Hsp90-family heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17509"
FT                   /db_xref="GOA:B1VRU1"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU1"
FT                   /protein_id="BAG17509.1"
FT                   /translation="MSGSVETLEFQAETRQLLRLVIHSIYSNKDIFLRELISNASDALD
FT                   KLRLESLTDSSLETESADPHIALEVDPEARTLTVRDNGIGMTREDLVELIGTIAKSGTA
FT                   GLLEKIKESKDAATAENLIGQFGVGFYSAFMVADQVTLLTRRAGTDTGTRWESDGEGTY
FT                   AIQSEDGLPVGTSVTLHLKPVDSEDGRADYLSESKIRQIVKQYSDFIRWPIRMATERTA
FT                   ADGATTRETDTLNSMKALWARPRTEVSEEEYHEFYQQISHDWLPPAETIHMRAEGTFEY
FT                   EALLFIPSQAPFDLFSRETKPGVQLYVKRVFIMDDCEALMPNYLRFVKGVVDAHDLSLN
FT                   VSREILQHDRQIHGVRRRLVKKVLGALKDMQSKDAERYAKVWEQFGRALKEGLVEDTDN
FT                   TETLLQLVSAASTHDPDRTTTLREYVERMKDGQDTIYYLTGESRAMVENSPHMEAVAAK
FT                   GYEVLILTDPVDEVWVDRVPAFDGHTLQSIAKGQVDLGESTDGEKEDDAAKAQREKDFA
FT                   ALLPWLTTALSEQVKEVRLSSRLTTSAACIVGDAHDVTPTLEKMYRAMGQEIPTVKRIL
FT                   ELNPSHPLVTALRTAHDADVDDPALKEVAELVYGSALLAEGGDLPDPARFTRLLADRLA
FT                   RTL"
     atgagcggca gtgtcgagac gctggaattc caggcggaga cccgccagtt gctccggttg        60
     gtgatccact cgatctactc gaacaaggac atcttcctgc gcgagctgat ctccaacgcc       120
     tccgacgccc tggacaagct gcggctggaa tcgctgaccg actccagcct ggagaccgaa       180
     tcggcggacc cgcacatcgc gttggaagtc gaccccgaag cccgcacctt gaccgtccgc       240
     gacaacggga tcggcatgac ccgcgaggac ctggtggagc tgatcggcac gatcgccaag       300
     tccggcaccg ccggcctgct ggagaagatc aaggagtcca aggacgccgc caccgccgag       360
     aatctgatcg gtcagttcgg cgtcggcttc tactcggcct tcatggtcgc cgaccaggtc       420
     accctgctca cccggcgggc cggcaccgac accggcaccc ggtgggagtc cgacggcgag       480
     ggcacctacg ccatccagtc cgaggacgga ctgcccgtgg gcacctcggt caccctgcac       540
     ctgaagcccg tcgacagcga ggacggacgc gccgactacc tgtcggagtc gaagatccgc       600
     cagatcgtca agcagtactc ggacttcatc cgctggccca tccgcatggc caccgagcgc       660
     accgccgccg acggcgcgac cacccgggag accgacacgc tcaactcgat gaaggcgctc       720
     tgggcccggc cccgcaccga ggtgagcgag gaggagtacc acgagttcta ccagcagatc       780
     agccacgact ggctgccccc ggccgagacg atccacatgc gcgccgaagg caccttcgag       840
     tacgaggcgc tgctgttcat cccctcgcag gcgcccttcg acctgttctc ccgcgagacc       900
     aagcccgggg tgcagctgta cgtcaagcgg gtgttcatca tggacgactg cgaagcgctc       960
     atgcccaact acctgcgctt cgtcaagggt gtcgtggacg cccacgacct gtcgctgaac      1020
     gtctcgcgcg agatcctcca gcacgaccgc cagattcacg gtgtgcgccg gcggctggtc      1080
     aagaaggtcc tcggcgccct caaggacatg cagtccaagg acgccgaacg gtacgcgaag      1140
     gtgtgggagc agttcggccg ggccctgaag gaaggcctgg tcgaggacac ggacaacacc      1200
     gagaccctgc tgcagctggt gtcggcggcc tccacccacg accccgaccg gaccaccacg      1260
     ctgcgcgagt acgtcgagcg catgaaggac ggccaggaca ccatctacta cctgaccggc      1320
     gagagccgcg cgatggtgga gaactccccg cacatggaag ccgtcgcggc gaagggctac      1380
     gaggtcctga tcctcaccga ccccgtcgac gaggtctggg tcgaccgggt tccggccttc      1440
     gacggtcaca ccctgcagtc catcgccaag ggccaggtcg atctcggcga gtccaccgac      1500
     ggcgagaagg aggacgacgc ggccaaggcc caacgcgaga aggacttcgc cgccctgctg      1560
     ccctggctga ccaccgcgct gtccgaacag gtcaaggagg tccgcctgtc atcgcgtctc      1620
     accacctcgg cagcctgcat cgtcggcgac gcccacgatg tgacgccgac cctggagaag      1680
     atgtaccggg cgatgggcca ggagattccc accgtcaagc ggatcctgga actcaacccc      1740
     tcgcacccgc tggtcaccgc cctgcgcacc gcacacgacg cggacgtcga cgaccccgcg      1800
     ctcaaggagg tcgccgagct ggtctacggc agcgcactgc tcgccgaagg aggcgacctg      1860
     cccgacccgg cccgcttcac ccggctgctc gccgaccgcc tggcccgcac cctgtaa         1917
//

If you have problems or comments...

PBIL Back to PBIL home page