(data stored in ACNUC7421 zone)

EMBL: AP009493.PE681

AP009493.PE681       Location/Qualifiers
FT   CDS_pept        complement(804324..804971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_681"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17510"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU2"
FT                   /protein_id="BAG17510.1"
FT                   /translation="MTAADQPSTARADAPGPASFIAAAAALAATDEALRDAQRRSPDAV
FT                   SPGPEQALASLMLLRQVREHLASWETGLIETARGAGASWADLARPLGVASRQAAERRYL
FT                   RGRPGAAGTTGEQRVAATRRARAADRATADWARANAADLRRLSGQIAALAPLAPDARSA
FT                   QDALRAALGAADAAELVAPLAGIRPHLDARHRGLVESLDALDAPGAQPRPWR"
     gtgaccgcgg cggaccagcc gtccacggcc cgtgccgacg cccccggccc ggcgtccttc        60
     atcgccgcgg cggcggccct cgccgccacg gacgaggccc tgcgcgacgc gcagcgccgg       120
     tcgcccgacg ccgtgagccc cggccccgaa caggcactgg cctccctgat gctgctgcgg       180
     caggtgcgcg agcatctcgc gagctgggag accgggctga tcgaaaccgc ccgcggggcg       240
     ggcgccagct gggccgatct cgcccgcccg ctcggtgtcg ccagccgcca ggccgccgaa       300
     cgccgctacc tgcgcggccg tccgggcgcc gccggaacca ccggcgaaca gcgcgtcgcg       360
     gccacgcgtc gggcgagagc cgccgaccgc gccaccgccg actgggcccg cgccaacgcc       420
     gccgacctgc gccgcctctc cgggcagatc gccgcgctgg cccccctcgc gcccgacgca       480
     cgctcggccc aggacgcgct gcgggccgca ctcggcgccg cggacgccgc cgagctcgtc       540
     gccccgctgg ccggcatccg cccccacctc gacgcgcgcc accgcggcct cgtcgagtcc       600
     ctcgacgccc tggacgcccc gggcgcacaa cctcgcccct ggcgatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page