(data stored in ACNUC7421 zone)

EMBL: AP009493.PE684

AP009493.PE684       Location/Qualifiers
FT   CDS_pept        complement(809259..810578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_684"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17513"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU5"
FT                   /protein_id="BAG17513.1"
FT                   /translation="MVAILRCTPGEVKFLDSRKRQEQLDAGWESVGERSEWTSRHVVLV
FT                   VTGQERGRPGVEYVGQARSGRSAGTFRRVVEVTQLHRIVPPVPMEALSDQLPLRHRDAV
FT                   DRSGVLTKRSGEELLNGLTTCRADLAAVIARLQERVGGIRILGRVRALFLEQRDATGLA
FT                   LQLGGFDRSIIEEAEFPEEGGGQIPVLATLPGHPAHEDHLVAHDAQRFSDWIGNDAEYL
FT                   ATRVFRKGDQQLFIANVNRLPAEETLGIDLIYHHVNRDSFILVQYKKMGQVGAGRSEWG
FT                   YRPDGDLDDQLKRMREVEDACTRLEQDPPTDYRFVHQPCWIKFCKSEQVAPKGDALIGG
FT                   MYLTREHVEWLRGRPGLAVGPKGGELFGYHTVPRYLDNTTFTQLVQDGWIGTRGRASDI
FT                   IQAQIKASLDGSRALVFAGLIGDDMTQAERTRERRGGSGS"
     atggtggcga tactgcggtg caccccaggt gaggtcaagt tcctcgatag ccgtaagagg        60
     caggagcaac tcgatgctgg ctgggagtcg gtcggagagc gtagcgagtg gaccagcagg       120
     catgtggtcc tggtggtgac cggccaggag agaggacgac caggcgtcga gtacgtgggg       180
     caggcccgga gcggtcgctc cgccggtacc tttcggcgtg tggtcgaggt gactcagctc       240
     catcgaatcg tgcctccagt tccgatggaa gccctatccg accagcttcc actccgacac       300
     cgggatgcag tcgaccggtc cggtgtgctg acgaagcggt ccggtgaaga gctgctgaac       360
     ggacttacca catgccgcgc ggatctggct gcagttatcg ctcggttgca ggaaagggtg       420
     ggtggtattc ggatcctcgg cagagtgcgg gcgctgttct tggagcagcg agacgccacc       480
     ggactggcac ttcaactggg tgggttcgac cggagcatca tcgaagaggc agagttcccg       540
     gaagagggtg gggggcagat acctgtcctc gctaccctgc cggggcatcc ggcgcacgag       600
     gaccaccttg tcgctcacga tgcgcaacgc ttctcggact ggatcggaaa tgacgcggag       660
     tatctcgcga cacgggtatt ccgcaagggc gaccagcagc ttttcatcgc caacgtgaac       720
     cgcctgccag ccgaggaaac cctgggaatc gatctgatct atcaccatgt gaaccgggac       780
     agcttcatac ttgtgcagta caagaagatg ggccaggttg gagctgggcg tagtgagtgg       840
     ggatatcggc cggacggtga tcttgacgac cagcttaagc gcatgaggga ggtggaggat       900
     gcgtgtacgc ggctggaaca ggatcctccg accgactacc gattcgttca ccagccatgc       960
     tggatcaagt tctgcaagtc cgaacaggtg gcgccgaagg gagatgcgct gattggtggc      1020
     atgtacctca cgcgtgaaca cgtcgagtgg ctgcgaggtc gacccggact ggctgtcggc      1080
     cccaaagggg gtgagctgtt cggctaccac acggtgcctc ggtatctcga caacacgaca      1140
     ttcactcaac ttgttcagga cggctggatc ggaacccgtg gcagggccag tgacatcatc      1200
     caggcccaga tcaaggccag ccttgacggc tcgcgggcgc tggtcttcgc agggctcatc      1260
     ggtgacgaca tgactcaggc cgaacgtaca cgtgaacgca ggggcggctc agggagctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page