(data stored in ACNUC7421 zone)

EMBL: AP009493.PE686

AP009493.PE686       Location/Qualifiers
FT   CDS_pept        complement(811947..815813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_686"
FT                   /product="hypothetical WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_686"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17515"
FT                   /db_xref="GOA:B1VRU7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033510"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU7"
FT                   /protein_id="BAG17515.1"
FT                   /translation="MAFPKAESLQRRRVRVREVVAPPVEDQDIDDVAVLILEESVSRNH
FT                   VARLRRPEVGSLVHRRWWAFGFPDGMLGNSSGGEIGEELGYGWVRLDTSARYPIQGGYS
FT                   GAALWSPDYGAVVGMVGQGQGGNGDGRAITLRAIDACLPEQKLHLLADWSAESAGESAM
FT                   AAWGWSLTDDPEAGRHWRPRARGVSTDAERGFRFCGRTAALQKIVSWLVGEEAKRQILV
FT                   VTGSPGVGKSAVLGRIVTTADVSLSASLPPDESVRAPEGSVACAVHAKSKSALEVAEEI
FT                   ARAASANLPARVSDLAPHIRDALESGGRTGFTVVIDALDEAASPDEARLILRRVAQPLA
FT                   ENLEDLGVRVVVGSRRSDDAGSLFDEFGLSTNILDLDNPEFFDFADLATYALATLQLRG
FT                   AERRDNPYNDVALAAPVADRIAQLSEGNFLVAGLIARAHGMYDHQPVGPERLTFPPTVD
FT                   AALHEYLDLLPDVDGVPANAVLTALAYAEAPGMPLDLWRVTISALGHAVPSEKHLLAFA
FT                   RSSAANFLVETSTSDPQNAVFRLFHQALNDALVRQRSAVRDEGAIASALLQHGQSVGWS
FT                   EAPAYLLRALPRHAERGRSVDQLLSDPTFALYADLRRLIPAATSASSPHARRQARLLRR
FT                   TLRALDASPSDRAALLSVTETLDNLGNTYSTSAHPAPYRARWAAAVPHEEEAILEGHRD
FT                   WVRTVCSVEAAGRQLLATASDDATVRLWDPETGELVRVLEGHSDYVLTVRTVATEQGKL
FT                   LLTTSADGTARVWDPNQGETVRRFDGIGDWVRSACIGRMAGRTVLATASDDRVVRFWNM
FT                   DTGREIRTVKAHHRHRIRAVCALGEVFAAAGDDGLIRLLDPRGGESIVLRGHGGSVNAL
FT                   CAFFLDERAMLATASADGTARVWDLESASQHVVLKGHREELNAVHAFSLEGRTVLATAS
FT                   DDGTARLWDPKTGNQLAVFNGHVDWVLDVCSLPLGGRTQLATAGSDGTVRLWNPNREQH
FT                   AGLRGSTSVGAACALPLEAGTALATASNNGAVSLVNPETGEQLRTIKGSHGWDSCVCAV
FT                   PVKGRTLLATSSTDRSARVWDPETSRQVRVLKGHGSRVKSMCILTSKGRTLLATGSADA
FT                   TARLWNPENGKQLRVLKGHTGWVLTMCVIPMDDRSVLATGSADGTARLWDPESGRQLHM
FT                   VKDPSGRVQSMCAVDVGGRAVLAAAGRGTIGLWNPANGEQLRILESNSEVRSMCAIGVN
FT                   GRSLLAVASDDRTVRLWDPANGQTVAEIPVGAAGRVVIEAGGLLLVSTWRGILALDLAS
FT                   RGLF"
     gtggccttcc ctaaggcgga gtctctgcag cgacgcagag tacgtgtgcg ggaggtggtg        60
     gctccgccgg tggaggatca ggacatcgat gatgtggcgg tgctgattct cgaagagtct       120
     gtctctcgga atcatgtcgc acgcctccgc aggcctgaag taggaagcct ggtgcatcgc       180
     cgctggtggg ctttcgggtt tcctgacggc atgctgggca actcctctgg aggtgagatc       240
     ggggaggagt tgggctacgg ctgggtacgg ctcgacacct ctgcgcgcta ccccattcaa       300
     gggggttaca gcggtgcggc tttgtggtcg ccggactacg gggcggtagt cggtatggtg       360
     ggccaggggc aaggcggcaa tggagacggc cgagccatca ctcttcgggc gatcgacgcc       420
     tgtctgccag agcagaagtt gcacctactc gcagactggt ccgcagagtc tgctggggaa       480
     agcgcgatgg cggcatgggg ttggagcctc actgacgatc cggaagccgg ccgccactgg       540
     cgtccccgcg cccggggcgt tagtacggat gctgagcgag ggttccgctt ctgtggccgg       600
     acagcagcac tccagaagat cgtttcctgg ctggtcggag aggaagccaa gcggcagatc       660
     ctcgtggtca ccggctctcc tggggtaggc aagtcggccg ttctcggacg catcgttacc       720
     acggctgatg tatctctctc tgcgtcgctt ccccctgacg agtcggtgcg agcaccggag       780
     gggtctgtgg cgtgcgctgt gcacgccaag tccaagtccg cgctggaagt ggccgaagaa       840
     atcgcccggg ctgcctcggc gaaccttccc gcgcgggtga gcgacctggc acctcatatc       900
     cgcgacgcgc tagagagcgg cggacgcact gggttcaccg tcgtcatcga tgcgctcgat       960
     gaggccgcca gccctgacga ggcgcgcttg atccttcgac gtgtcgccca acctctggca      1020
     gagaacctgg aagacctcgg cgtgcgcgtc gtggtgggca gcaggcgatc cgatgacgcg      1080
     ggatcactct tcgacgagtt tgggctgtcc accaacatcc tggaccttga caaccctgag      1140
     tttttcgact tcgccgacct ggctacatac gccctggcca ccctgcagct acgcggcgcc      1200
     gagcgccgtg acaaccctta taacgacgtt gctttggccg cccctgtggc tgatcggatc      1260
     gcccagctct cggagggtaa cttcctcgtc gcagggttga tcgcccgcgc acacgggatg      1320
     tacgaccacc agccagtcgg gccagagcgg ctcacgttcc cgcccacagt ggatgcagcg      1380
     ctgcacgagt atctcgacct gctgcccgat gtcgatgggg tgccggccaa tgctgtactc      1440
     accgcactgg cctacgccga ggctccaggc atgccgctgg atctctggcg cgtcaccatc      1500
     agcgccctgg gacacgccgt gccatcagag aagcacctgc ttgccttcgc tcgttcgtcc      1560
     gctgccaact tccttgttga gaccagtaca tccgatccgc agaatgctgt gttccggctc      1620
     tttcaccagg ccctcaacga cgcactcgtg cgccagcgat ccgcagtcag ggacgaaggc      1680
     gcgatcgcca gtgctctcct acagcatggg cagtccgtcg ggtggtctga agcgcccgcc      1740
     tacctgctgc gtgcgctacc gcggcacgct gaacgaggca ggagcgtcga ccagcttctg      1800
     agcgatccga cattcgccct ctacgctgat ctgcgtcgcc ttatcccggc cgcaacctcg      1860
     gcctcgtcac cccatgcgcg tcggcaagca cgcctgctcc gcaggacgct acgtgcgctc      1920
     gacgcatctc catccgatcg cgccgccctg ttgagtgtta cagagaccct cgacaacctg      1980
     ggcaatacct acagcacgtc cgctcaccct gctccctatc gcgcgcggtg ggctgctgcc      2040
     gttccgcacg aagaggaagc gatcctcgag ggccacaggg attgggtccg aaccgtgtgc      2100
     agcgtggagg cggcggggcg ccagctgctg gcgaccgcga gcgacgatgc cactgtccgg      2160
     ctttgggatc ccgagacagg ggaactcgtg cgagttctgg aagggcactc cgactatgtc      2220
     ctgacggtca gaacagtcgc gacagagcag ggcaaactac tcctcacgac gagtgctgac      2280
     ggaaccgccc gagtatggga ccccaaccag ggcgagacag tccgtcggtt cgacggcatc      2340
     ggtgactggg tgcggtccgc gtgcatcgga cgaatggctg gtcgcactgt ccttgccacc      2400
     gcgagtgacg accgggtcgt ccggttttgg aatatggaca cgggcaggga gatccgcacg      2460
     gtcaaggctc atcaccggca tcgcatccgg gccgtgtgcg ctctggggga ggtcttcgct      2520
     gctgcgggag acgacggcct aattcgcctg ctggaccccc ggggcggtga atccatcgtc      2580
     ctccgcggcc acggtggcag cgtgaacgcc ctgtgcgcct tctttctcga cgagcgcgcc      2640
     atgctcgcca cggcgagcgc tgatggcacc gcccgcgtct gggatctcga gtctgccagt      2700
     caacacgttg tcctgaaggg ccaccgtgaa gagctgaacg cagtgcatgc cttctccctc      2760
     gaggggcgca ctgtgctcgc caccgcgagc gacgatggca ctgcccgcct ctgggatccc      2820
     aaaaccggca atcagctggc tgtcttcaac ggccatgtgg attgggtcct ggacgtgtgt      2880
     tcgctgcccc tagggggccg cacccagctc gccactgcgg gcagtgatgg gacagtccgc      2940
     ctctggaacc ccaaccggga acagcacgca ggcctgaggg gcagcacgag tgttggcgcg      3000
     gcatgcgctc tcccactcga ggcagggacc gctctcgcca ccgcgagcaa caacggagcc      3060
     gtctcccttg tgaaccctga gaccggcgag cagctacgca ccattaaggg gagtcacggt      3120
     tgggacagct gcgtttgcgc cgtcccagtc aagggccgca ccctgctcgc tacgagcagc      3180
     acggaccgga gcgcccgcgt ctgggacccc gagaccagta gacaggtcag ggtcctcaag      3240
     gggcacggca gccgcgtgaa atccatgtgc attctcacct cgaaggggcg caccctcctg      3300
     gccactggca gtgcggatgc aacggcgcgc ctgtggaacc cggaaaacgg caaacaactt      3360
     cgcgtcctca aggggcacac cgggtgggtc ctgaccatgt gcgtcatacc catggacgat      3420
     cgttctgtcc tcgcaacagg tagtgccgac ggcacagcgc gtctctggga tcctgagagt      3480
     ggcaggcaac tgcacatggt gaaggacccc agtggacgag ttcagtccat gtgtgccgtt      3540
     gacgtaggcg gccgcgccgt ccttgcggcc gccggtcgcg gcaccatcgg gctctggaac      3600
     ccagccaacg gtgaacaact ccgcatcctt gagagcaaca gcgaagtgcg ctccatgtgc      3660
     gccatcggcg tcaatggccg ttcactccta gccgttgcca gtgacgaccg caccgtacgg      3720
     ctctgggatc cggcgaacgg ccagacagtg gcagaaatcc cagtgggagc tgctggccgt      3780
     gtagtgatcg aggcgggcgg cttgctgctg gtaagcacgt ggcgtggcat ccttgccctg      3840
     gatctggctt ctagagggct tttttga                                          3867
//

If you have problems or comments...

PBIL Back to PBIL home page