(data stored in ACNUC7421 zone)

EMBL: AP009493.PE687

AP009493.PE687       Location/Qualifiers
FT   CDS_pept        complement(815987..816319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_687"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17516"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU8"
FT                   /protein_id="BAG17516.1"
FT                   /translation="MRGRRMASQVVSYQADEETEVRFEIETTDEWYPVSSDEVVGRIRE
FT                   AVRPAVEGARTVLEQVKALQPGEVQVKFGVKVTGTANWLVAKAATEANFEITLIWPRDQ
FT                   AASSAT"
     gtgaggggga gacggatggc gtcgcaggtc gtttcatacc aggcagacga agagacggag        60
     gtccgattcg aaatcgagac gactgacgag tggtatccgg tgagctctga cgaggtcgtg       120
     ggcaggatcc gcgaggccgt gcggccggct gtcgagggtg cccgcacggt gttggagcag       180
     gtcaaggcac tgcagccggg tgaggttcag gtgaagttcg gggtgaaggt caccggaacg       240
     gcgaactggt tggtggctaa ggcggccacc gaggcgaact tcgaaatcac actgatctgg       300
     ccgcgtgacc aggctgcctc aagcgcgacg tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page