(data stored in ACNUC7421 zone)

EMBL: AP009493.PE691

AP009493.PE691       Location/Qualifiers
FT   CDS_pept        complement(819395..819703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_691"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17520"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV2"
FT                   /protein_id="BAG17520.1"
FT                   /translation="MREARRMSSVGGMSHPQSYELLLIPDHSRTRTGAPGRPIRSAVVA
FT                   ATGETGASGYPRYAGEGMEADVDPETRTVEAVLIDGEELDYGMSVRVAGAQGERPAS"
     atgcgcgagg cgcgccggat gtctagcgtc ggaggcatga gccacccgca gagttacgaa        60
     ctcctcctga tccccgacca cagcaggaca cggaccgggg cccccggacg gccgatccgg       120
     tccgcggtcg tcgccgccac cggcgagacg ggggcctcgg gctacccccg gtacgcgggc       180
     gagggcatgg aggcggacgt cgacccggag acccggacgg tggaggccgt gctcatcgac       240
     ggcgaggaac tggactacgg catgtcggtc cgcgtcgccg gggcccaggg agagcgcccg       300
     gcgtcctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page