(data stored in ACNUC7421 zone)

EMBL: AP009493.PE693

AP009493.PE693       Location/Qualifiers
FT   CDS_pept        820891..821358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_693"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17522"
FT                   /db_xref="GOA:B1VRV4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV4"
FT                   /protein_id="BAG17522.1"
FT                   /translation="MTFHDSAYRSDNPFDVPGSSGPTATTEADTDDVGPVRTSYAPDRD
FT                   GDPDPGEIVWTWVPFEENDGRGKDRPVLVVAREEAGTLLGVQLSSKRHDGEHEWVALGA
FT                   GPWDSSGRPSWAGLDRVLRVHEDGMRREACALDRERFDRVAGRLRERYGWS"
     atgacgttcc acgacagcgc gtaccgttcc gacaacccct ttgacgtgcc cggcagcagc        60
     gggccgacgg ccacgacgga ggccgacacc gacgacgtgg gccccgtgcg cacctcctac       120
     gcccccgatc gcgacgggga tcccgatccc ggcgagatcg tctggacctg ggtgcctttc       180
     gaggagaacg acggacgggg aaaggaccgc ccggtgctcg tggtggcccg ggaggaggcg       240
     ggcacgctgc tcggcgtgca gctctccagc aagcggcacg acggggagca cgagtgggtg       300
     gcactgggcg cgggcccctg ggacagctcg gggcgcccgt cctgggccgg tctcgaccgg       360
     gtgctgcggg tccatgagga cgggatgcgc cgggaggcgt gcgccctgga ccgggagcgg       420
     ttcgaccggg tcgcggggcg gctgcgcgag cggtacggct ggagctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page