(data stored in ACNUC7421 zone)

EMBL: AP009493.PE696

AP009493.PE696       Location/Qualifiers
FT   CDS_pept        823807..825210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_696"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_696"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17525"
FT                   /db_xref="GOA:B1VRV7"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR032890"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV7"
FT                   /protein_id="BAG17525.1"
FT                   /translation="MTDHREGTRHREHSDAFDPAGSTASTGFPVAAGIDPEALRRQALA
FT                   ALLSARERTALLTDSVDDGELTAQHSPLMSPLVWDLAHIGNQEEQWLLRAVGGRQALRP
FT                   EIDGLYNAFEHSRASRPSLPLLAPAEARTYASDVRGRALDLLEGVPLHEGGRPLERAGF
FT                   AFGMIAQHEQQHDETMLITHQLRSGPAALTAPEPPAPVEAEVLGDEVLVPGGPFTMGTS
FT                   AEPWALDNERPAHRREVAAFHLDTSPVTCGAYLRFIEDGGYGDSRWWAPEGWAMVREHD
FT                   LTAPLFWRREAGQWLRRRFGVTEPVPQDEPVLHVSWYEADAYARWAGRRLPTESEWEKA
FT                   ARHDPVSDRSRRYPWGDGDPTPERANLGQRHLRPARSGAYPAGRSPSGAGQLIGDVWEW
FT                   TSSDFLPYPGFVAFPYREYSEVFFGPGHKVLRGGSFAVGEVACRGTFRNWDLPVRRQIF
FT                   SGFRTARSA"
     atgaccgatc accgtgaagg cacccggcac cgcgaacact ccgacgcctt cgatccggcc        60
     ggctccaccg cgtcgaccgg gttccccgtc gcagccggca tcgatccgga ggcgctgcgg       120
     cggcaggccc tcgcagcgct gctgtccgcg cgcgagcgca ccgccctgct caccgacagc       180
     gtggacgacg gcgaactgac cgctcagcac tccccgttga tgtcgccact ggtctgggac       240
     ctggcgcaca tcggcaacca ggaggagcag tggctgctgc gcgccgtcgg cggccgccag       300
     gcgctgcgcc cggagatcga cggtctctac aacgccttcg agcactcccg tgcctcgcgc       360
     ccctcgctgc cgctgctggc accggccgag gccaggacct acgcctccga cgtgcggggg       420
     cgggcactgg acctgctgga gggcgtaccg ctgcacgagg gcggacgccc gttggagcgg       480
     gccgggttcg ccttcggcat gatcgcccag cacgaacagc agcacgacga gacgatgctg       540
     atcacccatc agctgcgctc gggacccgcc gcgctcaccg cgcccgagcc gcccgcgccc       600
     gtcgaggccg aggtgctcgg ggacgaagtg ctggttcccg gcggcccgtt cacgatgggc       660
     acctcggccg agccgtgggc cctggacaac gagcggcccg cccaccggcg cgaggtggcg       720
     gcgttccacc tggacacctc accggtcacc tgtggcgcct accttcgctt catcgaggac       780
     ggcgggtacg gggacagccg ctggtgggcc cccgagggct gggccatggt ccgtgaacac       840
     gacctgaccg caccgctgtt ctggcggcgg gaggcgggac agtggctgcg ccgccggttc       900
     ggggtgaccg agccggtacc ccaggacgag ccggtgctgc acgtcagctg gtacgaggcg       960
     gacgcgtacg cccgctgggc cggccggcga ctgcccaccg agagcgagtg ggagaaggcc      1020
     gcccgtcacg accccgtctc cgaccgctcc cggcgctacc cgtggggcga cggggacccg      1080
     acgccggagc gggccaacct gggccagcgc cacctgcggc cggcccggtc cggcgcctat      1140
     ccggcggggc gttccccctc gggggcgggg cagctgatcg gtgacgtgtg ggagtggacc      1200
     tccagcgact tcctgcccta tccggggttc gtggcctttc cctaccgcga gtattcggaa      1260
     gtgttcttcg ggccggggca caaggtgctg cgcggcgggt cgttcgccgt gggcgaggtc      1320
     gcctgccggg gcaccttccg caactgggac cttccggtac ggcggcagat cttctccggc      1380
     ttccgcaccg cgaggagcgc ctga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page