(data stored in ACNUC7421 zone)

EMBL: AP009493.PE697

AP009493.PE697       Location/Qualifiers
FT   CDS_pept        825210..825965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_697"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17526"
FT                   /db_xref="GOA:B1VRV8"
FT                   /db_xref="InterPro:IPR017808"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR032889"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV8"
FT                   /protein_id="BAG17526.1"
FT                   /translation="MCRHIAYVGDPVALGEILLRPPHALVRQSWAPRRQRHGTVNADGF
FT                   GVGWYAEGDPVPGRYRRQGPIWGDETFADLARVVRSTALLAAVRDATEAGADGEAAAAP
FT                   YTAGRQLFSHNGMVRGWPGSLADAAAALPAERLLALAARNDSALIWALIRHRTDAGDDA
FT                   PRAVAETVREVAAAAPGSRLNLLLTDGETITATAWGDTLWYLTTPGRRTAVASEPYDDD
FT                   PLWREVPDRTLLVATSTDVLLTPLKEPTA"
     atgtgccgtc acatcgccta cgtgggcgat cccgtggcac tcggcgaaat tctgctgcgg        60
     cctccgcacg ccctggtgcg gcagtcctgg gcgccgcgcc gccaacgcca cggcacggtg       120
     aacgcggacg gcttcggggt cggttggtac gccgaagggg acccggtgcc cggtcgctac       180
     cgccgtcagg gaccgatatg gggcgacgag accttcgccg atctggcccg ggtggtgcgc       240
     agcaccgcac tgctcgccgc cgtgcgggat gccaccgagg cgggtgcgga cggggaggcc       300
     gcggccgcgc cgtacaccgc cgggcggcag ctgttcagcc acaacgggat ggtgcggggc       360
     tggcccgggt cgctcgccga cgcggccgcc gccctgcccg ccgagcggct cctggcgctg       420
     gccgcccgca acgactcggc gctgatctgg gcgctgatcc gccaccggac cgacgccggc       480
     gacgatgcgc cgcgggccgt cgcggagacc gtgcgggagg tcgcggccgc cgcgcccggc       540
     tcccggctga atctgctcct caccgatggg gagacgatca cggcgaccgc ctggggcgac       600
     accctctggt acctcacgac accgggccgg cgcaccgcgg tcgcctcgga gccctacgac       660
     gacgacccgc tctggcgcga ggtccccgac cgcacgctgc tggtcgcgac ctccacggac       720
     gtcctgctca ccccgctcaa ggagcccacc gcgtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page