(data stored in ACNUC7421 zone)

EMBL: AP009493.PE698

AP009493.PE698       Location/Qualifiers
FT   CDS_pept        825962..826924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_698"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17527"
FT                   /db_xref="GOA:B1VRV9"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032888"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV9"
FT                   /protein_id="BAG17527.1"
FT                   /translation="MSPFLLTRTLPVDATGAALRADVLSGLTRHPKTLPPKWFYDARGS
FT                   ELFEEITRLPEYYPTRAEREILQARAEEIAAASGARTVIELGSGSSEKTRHLLDVLPEL
FT                   HSYVPVDVSESALTGAAESLLVEHPGLSVHALIADFTGGLALPGTPGPRLVVFLGGTIG
FT                   NLLPEERAGFLRSVRSLLSPGDALLLGTDLVKDEETLVAAYDDAAGVTAAFNKNVLSVV
FT                   NRELGADFPLDDFDHLAVWNPRDRWIEMRLRARRALNVKIRELDLVVPFEAGEELRTEV
FT                   SAKFRREDVREELAAAGMRLTQWWTDSAGRFALSLATAV"
     gtgagtccct tcctgttgac ccgcaccctg ccggtggacg cgacgggcgc ggcgctgcgc        60
     gccgacgtcc tcagcggcct gacccggcac cccaagaccc tgccgccgaa gtggttctac       120
     gacgcccgcg gcagcgagct gttcgaggag atcacccggc tgccggagta ctacccgacc       180
     cgtgccgaac gggagatcct ccaggcgcgc gccgaggaga tcgccgcggc gtcgggcgcc       240
     cggacggtga tcgagctggg ctcgggttcg tccgagaaga cccgtcatct gctggacgtg       300
     ctccccgagt tgcacagtta cgtccccgtg gacgtgagcg agagcgcgct gacgggggcg       360
     gccgagtcgc tgctcgtcga gcaccccggc ctgtccgtcc acgcgctgat cgccgacttc       420
     accggcggcc tggccctgcc ggggacgccg ggcccccggc tggtggtgtt cctggggggc       480
     accatcggca atctgctgcc ggaggagcgg gcggggttcc tccggtcggt gcgctcgctg       540
     ctctcgccgg gcgacgcgct gctcctcggc acggacctgg tgaaggacga ggagacgctg       600
     gtggccgcgt acgacgacgc ggccggggtg acggcggcct tcaacaagaa cgtcctcagc       660
     gtcgtcaacc gtgagctggg ggccgacttc ccgctcgacg acttcgatca cctcgcggtg       720
     tggaacccgc gggaccggtg gatcgagatg cggctgcggg cccggcgggc gctgaacgtc       780
     aagatccgtg agctggacct cgtggtgccg ttcgaggccg gtgaggagct gcgtacggag       840
     gtgtcggcga agttccggcg ggaggacgtc cgtgaggagc tggccgccgc cgggatgcgg       900
     ctgactcagt ggtggacgga ctcggcgggg cggttcgccc tgtcgctggc cacggcggtc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page