(data stored in ACNUC7421 zone)

EMBL: AP009493.PE7

AP009493.PE7         Location/Qualifiers
FT   CDS_pept        complement(7112..7642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_7t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_7t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16836"
FT                   /db_xref="GOA:B1VKK5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK5"
FT                   /protein_id="BAG16836.1"
FT                   /translation="MKVKKDLDCEECIMIWSAGQKFREGDVCKGVVSDVFDFGVFVDLG
FT                   GCVGFVNPSEITWIRYTEITEVICEGREVNFLVIGHALAREQVLLSIKGLEEDPIKKFA
FT                   RERFGASFTGSVEMVTPVGLHVSLPGGMGGLLPESAMAGTADRYRVGDEISVEVARINL
FT                   HDRQIELSLRTPT"
     ttgaaggtta aaaaggactt agattgtgag gaatgcataa tgatttggtc ggcagggcag        60
     aagtttaggg agggtgatgt ctgtaaaggg gtggtctctg atgtcttcga cttcggcgtt       120
     ttcgtagatc ttgggggatg cgtgggattc gtcaacccct ctgagatcac atggattagg       180
     tacacagaaa tcacggaagt gatttgcgaa gggcgcgagg tgaacttcct ggtaatcggt       240
     catgcccttg cgcgagagca agttctcctc tccatcaagg gcttggagga agacccaatt       300
     aagaaatttg cacgtgagcg attcggggca tcctttactg gaagtgtcga gatggtgacg       360
     cctgtcggtc ttcacgtttc attgccgggt ggaatgggcg ggctactccc tgagtctgca       420
     atggccggta ctgctgatag atatcgagtt ggtgatgaga tatctgtcga ggttgccaga       480
     attaatcttc atgaccgcca gatcgagcta tcgctgagaa ctcctacatg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page