(data stored in ACNUC7421 zone)

EMBL: AP009493.PE700

AP009493.PE700       Location/Qualifiers
FT   CDS_pept        complement(827745..828593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17529"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW1"
FT                   /protein_id="BAG17529.1"
FT                   /translation="MTALPVAPLPASAFVPTPDSAPAPLPASAPAPGPAGAPEPPYRVS
FT                   LATGPEDVRAAQRLRHLVFAGELGARLEGPEPGLDSDAFDAYCDHLLVRETATGDVVAT
FT                   YRLLPPDRARIAGRLYAESEFDLTRLAPIRDDLVEVGRSCVHPAHRDGAVIALVWAGLA
FT                   RYMERTGHTWIAGCCSLPLADGGASAARSWNTVRASHLAPEKYWVTPHRLWDSSAHGTG
FT                   TGSRADLPPLLRGYLRLGAQICGAPAYDPDFDVADLYVLLSLRRTDPRYLRHFLSLAPS
FT                   R"
     atgaccgcgc tgcccgtcgc cccgctcccc gcctccgcgt tcgtcccgac ccccgactcc        60
     gccccggccc cgctccccgc ctccgccccg gcccccggtc ccgcaggcgc cccggaaccg       120
     ccctaccggg tctccctcgc caccggtccc gaggacgtac gcgcggccca gcgcctgcgc       180
     cacctcgtgt tcgccgggga actcggggcc cggctggaag ggcccgagcc cggcctggac       240
     agtgacgcct tcgacgcgta ctgcgaccac ctgctggtgc gcgagaccgc caccggggac       300
     gtcgtcgcca cctaccggct gctgccgccg gaccgggccc ggatagccgg acgcctctac       360
     gcggagagcg agttcgacct cacccggctc gccccgatcc gcgacgacct ggtcgaggtc       420
     ggccgctcct gcgtccaccc cgcacaccgc gacggcgcgg tcatcgccct cgtctgggcc       480
     ggactcgccc gctacatgga gcgcaccggc cacacctgga tcgcgggctg ctgctccctc       540
     cccctggccg acggcggggc gagcgccgcc cggagctgga acaccgtccg cgcgagccac       600
     ctcgccccgg agaagtactg ggtcaccccg caccgcctgt gggactcctc cgcgcacggc       660
     accggaaccg gctccagggc ggacctcccg ccgctgctcc gcggctacct ccggctcggc       720
     gcccagatct gcggagcccc cgcgtacgac cccgacttcg acgtcgccga cctgtacgtc       780
     ctgctctcgc tgcgccgcac cgacccgcgc tacctgcgcc acttcctctc cctggccccg       840
     tcgcgatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page