(data stored in ACNUC7421 zone)

EMBL: AP009493.PE701

AP009493.PE701       Location/Qualifiers
FT   CDS_pept        complement(828816..830072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_701"
FT                   /product="putative sugar ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_701"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17530"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW2"
FT                   /protein_id="BAG17530.1"
FT                   /translation="MKNRILAGAIALVSSVALGGCGFIPGSGSGDRTVTVWLMKDSVSP
FT                   GFLDKFTRSYEEENPSIQLDFKIQEWSGIGPKVLSALEGDDAPDVIEVGNTQVAQYAES
FT                   GGLRDLTLESMRDLGSEDWLPGLAQPGSINGVQYGIPWYAANRVVIYNKEIFEGAGIDT
FT                   LPKTRDEWIAVTEKLNKAGNQGIYLAGQNWYVLAGFIWDEGGELADENGGDWQGALDTP
FT                   EALAGMEFYQELQALGDGPTDADEEKPPQTDVFAKGDVAQIISTPGSAALIEQKNPELK
FT                   GRLGYFPIPGKSSKAPGSVFTGGSDLIVPKKADERTAGIAVVKALASEKWQTELARGMS
FT                   YVPNKPSLAHVIEGEEGTAAMAEGATRGRATPNSPQWARVEAENPIKPYMTAVLEGGDP
FT                   AREAKAASERITALLAGSG"
     gtgaagaacc gcattctggc cggagccatc gcgcttgtct cgtccgtcgc actcggcgga        60
     tgcggcttca tacccggctc gggcagcggt gaccgcacgg tgacggtctg gctgatgaag       120
     gacagcgtct cgcccggctt cctggacaag ttcacccgct cgtacgagga ggagaacccc       180
     tccatccagc tggacttcaa gatccaggag tggagtggca tcggccccaa ggttctctcg       240
     gcgctggagg gcgacgacgc ccctgacgtg atcgaggtcg ggaacaccca ggtcgcgcag       300
     tacgcggaga gcggcggcct gcgcgatctg accctcgaat cgatgcgcga cctgggcagc       360
     gaggactggc tgcccggcct ggcccagccg ggcagcatca acggcgtgca gtacggcatc       420
     ccgtggtacg cggccaaccg ggtggtgatc tacaacaagg agatcttcga gggggcgggt       480
     atcgacaccc tcccgaagac gcgcgacgag tggatcgccg tcaccgagaa gctcaacaag       540
     gccggcaacc agggcatcta cctggcgggt cagaactggt acgtgctcgc cggcttcatc       600
     tgggacgagg gcggggaact cgccgacgag aacggcggcg actggcaggg cgccctggac       660
     accccggagg ccctcgcggg catggagttc taccaggaac tccaggcgct cggcgacgga       720
     cccacggacg ccgacgagga gaagcccccg cagaccgacg tcttcgccaa gggcgatgtc       780
     gcgcagatca tctcgacccc gggcagcgcc gcgctcatcg agcagaagaa ccccgaactc       840
     aagggaaggc tgggctactt ccccatcccc ggcaagtcct cgaaggcccc gggctcggta       900
     ttcaccggcg gctccgacct catcgtcccg aagaaggccg acgagcgcac cgccgggatc       960
     gccgtcgtca aggcgctggc gagcgagaag tggcagacgg agctcgcccg gggcatgagc      1020
     tacgttccca acaagccgag tctcgcccat gtcatcgagg gcgaagaggg caccgcggcg      1080
     atggccgagg gcgccacccg cggccgtgcc acccccaact cgccccagtg ggccagggtc      1140
     gaggcggaga acccgatcaa gccgtacatg acggccgtgc tcgagggcgg cgacccggcc      1200
     cgcgaggcca aggccgcctc cgagcgcatc accgcgttgc tcgccggcag cggctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page