(data stored in ACNUC7421 zone)

EMBL: AP009493.PE702

AP009493.PE702       Location/Qualifiers
FT   CDS_pept        complement(830491..830979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_702"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17531"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW3"
FT                   /protein_id="BAG17531.1"
FT                   /translation="MDTDARPLAVFDLDGTLADTAHRQHFLEGPKRDWSGFFAAAVDDP
FT                   PLAEGVRMVLASAEECRIVYLTGRPERCRRDTVAWLSRQGLPEGTLFMRRNDDRRPARR
FT                   TKLDVLRQLGRKERVRMLVDDDELVCDAAQVAGFPVVRALWADPSAALKDAQEREGRT"
     gtggacaccg acgcacggcc gctggccgta ttcgacctgg acggcacgct cgcggacacc        60
     gcccaccggc agcacttcct ggaaggcccg aagcgcgact ggtccggctt cttcgccgct       120
     gccgtggacg acccgccgct cgcggagggc gtccggatgg tgctggcgag cgccgaggag       180
     tgccgaatcg tctatctgac cggacgcccc gagcgctgcc gtcgcgacac cgtggcctgg       240
     ctgagccgtc aggggctgcc ggagggcacg ctgttcatgc ggcgcaacga cgaccggcgc       300
     cccgcgcgcc ggacgaagct cgacgtcctt cggcagttgg ggcgcaagga gcgggtgcgc       360
     atgctcgtgg acgacgacga actggtctgc gacgcggccc aggtggccgg atttcctgtg       420
     gtgcgtgctc tctgggccga cccgtcggcg gcgctgaagg atgcccagga acgcgagggg       480
     cggacctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page