(data stored in ACNUC7421 zone)

EMBL: AP009493.PE704

AP009493.PE704       Location/Qualifiers
FT   CDS_pept        832408..834825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_704"
FT                   /product="putative excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_704"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17533"
FT                   /db_xref="GOA:B1VRW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW5"
FT                   /protein_id="BAG17533.1"
FT                   /translation="MHSPHDPYVRVRGAREHNLKNVRVDIPRDTLTVFTGVSGSGKSSL
FT                   AFGTIYAEAQRRYFESVAPYARRLIHQVGAPAVGEITGLPPAVSLEQRRSAPGARSSVG
FT                   TVTTLSNSLRLLFSRAGDYPPGAERLDSDSFSPNTAVGACPECHGLGRIHRTDEALLVP
FT                   DPSLSIREGAIAAWPGAWQGKNLRDVLDALGHDVDRPWRELDPKDREWILFTDEQPVVT
FT                   VHPVRDAGRIQRPYQGTYMSARRYVLHTFADTRSRALRAKAERFLTSAPCPVCGGSRLR
FT                   PEAMAVTFAGRTIAELAGLPLSALAEVLSGAGAGGEETARVLTADLLARIGTVTELGLG
FT                   YLSLDRTAPTLSSGELQRLRLATQLRSGLFGVVYVLDEPSAGLHPADTEALLGVLGRLK
FT                   EAGNSVFVVEHQMDVVRRADWLVDVGPLAGEHGGRVLHSGPPEGLARVPESATRRFLFE
FT                   EGPAPVREPRVPTGWIRLSGVERHNVRGADAAFPLGVFTAVTGVSGSGKSTLVGQVLAG
FT                   VLADRQAGEEATGAGERFCASVTGLEAVDRLVQVDQKPIGRTPRSNLATYTGLFDAVRK
FT                   LFAGTDAARERGYTAGRFSFNVSGGRCETCQGEGFVSVELLFLPSTYAPCPDCHGARYN
FT                   PRTLDVTLNGLTIAQVLELTVESAASFFAGTPAAERALTTLLDVGLGYLRLGQPATELS
FT                   GGEAQRIKLAAELQRTRRGHTLYLLDEPTTGLHPADVEVLMRQLHSLVDAGGTVVVVEH
FT                   DMAVVAGADHVIDLGPEGGDRGGRIVAAGTPAEVAREAGSRTAPYLAKALRH"
     atgcactccc cccacgatcc gtacgtccgc gtgcgcggcg cccgcgagca caacctcaag        60
     aacgtccggg tcgacatccc gcgcgacacc ctgaccgtgt tcacgggcgt gtccgggtcc       120
     gggaagtcct cgctcgcctt cgggaccatc tacgcggagg cccagcgccg ctacttcgag       180
     tccgtggccc cctacgcccg gcggctgatc catcaggtgg gcgcgcccgc cgtcggggag       240
     atcaccgggc tgccccccgc cgtctcgctg gagcagcggc ggtccgcccc gggggcccgg       300
     tcctccgtcg gcacggtgac gacgctctcc aactcgctgc gcctgctctt ctcccgtgcg       360
     ggcgactatc cgccgggggc cgagcgactg gactccgact ccttctcccc caacaccgcc       420
     gtcggggcgt gcccggagtg ccacgggctg gggcggatcc accggacgga cgaggcgctg       480
     ctcgtcccgg acccctcgct gtcgatccgg gagggcgcga tcgccgcgtg gccgggggcg       540
     tggcagggga agaacctgcg ggacgtgctg gacgccctgg gccacgacgt cgaccggccg       600
     tggcgggagc tggatccgaa ggaccgcgag tggatcctgt tcaccgacga gcagccggtg       660
     gtgacggtcc atccggtgcg ggacgcgggc cggatccaac gcccgtacca gggcacgtac       720
     atgagcgcgc ggcgctatgt gctgcacacc ttcgccgaca ccaggagccg ggccctgcgg       780
     gcgaaggcgg agcgcttcct gaccagcgcc ccgtgtccgg tgtgcggcgg gagccggctg       840
     cggccggagg cgatggcggt gaccttcgcg gggcggacca tcgcggagct ggccgggctc       900
     ccgctgtccg cgctggccga ggtgctgtcc ggtgcggggg cgggcggcga ggagacggcc       960
     cgggtgctga cggccgatct gctggcgcgg atcgggacgg tgacggagct gggtctcggc      1020
     tatctgagcc tggaccggac cgctccgacg ctgtcctccg gcgagctgca acggctgcgg      1080
     ctggcaacgc agttgcggtc gggactcttc ggtgtcgtgt acgtcctgga cgagccgtcg      1140
     gccgggctgc acccggcgga caccgaggcg ctgctcgggg tgctgggccg cctgaaggaa      1200
     gccgggaact cggtcttcgt ggtggagcac cagatggatg tggtgcggcg ggcggactgg      1260
     ctggtggacg tgggtccgct ggccggcgag cacggcgggc gggtgctgca cagcgggccg      1320
     cccgaggggc tcgcccgggt gccggagtcg gcgacgcggc ggttcctgtt cgaggagggg      1380
     cccgcgcccg tgcgggagcc acgggtgccg accgggtgga tccggctctc cggcgtcgag      1440
     cggcacaatg tgcggggggc cgacgcggcg ttcccgctcg gggtgttcac cgcggtgacc      1500
     ggggtgtccg gatcgggcaa gtcgaccttg gtcggccagg tgctcgccgg agtgctggcg      1560
     gaccggcagg cgggtgagga ggcgaccggg gcgggcgagc ggttctgcgc ttccgtcacc      1620
     ggtctcgagg cggtggaccg gctcgtccag gtcgaccaga agcccatcgg ccgtacgccc      1680
     cggtccaatc tggccacgta cacgggtctg ttcgacgccg tgcggaagct gttcgcgggg      1740
     acggacgcgg cgcgggagcg ggggtacacg gcggggcggt tctcgttcaa cgtgagcggt      1800
     gggcggtgcg agacctgcca gggcgagggg ttcgtctcgg tggagctgct gttcctgccg      1860
     agcacctacg cgccctgtcc ggactgccac ggcgcccggt acaacccccg gaccctggac      1920
     gtcacgctga acgggctgac gatcgctcag gtcctggagc tgaccgtgga gtcggcggcc      1980
     tccttcttcg ccgggacgcc ggccgccgag cgggcgctga ccaccctgct ggacgtgggg      2040
     ctcggctatc tgcggctcgg tcagcccgcc acggagctgt ccggcggtga ggcgcagcgc      2100
     atcaagctgg cggcggagct ccagcgcacc cggcgcggac acacgctgta tctgctggac      2160
     gagccgacga cggggctgca tccggccgat gtggaggtgc tgatgcggca gttgcactcc      2220
     ctggtcgacg ccggcggcac ggtggtggtc gtggagcacg acatggccgt ggtggcgggc      2280
     gcggaccacg tcatcgacct gggcccggag ggcggggacc ggggcggccg gatcgtggcg      2340
     gccgggacgc cggcggaggt ggcgcgcgag gccgggagcc gtacggcgcc gtatctggcg      2400
     aaggcgctgc ggcactga                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page