(data stored in ACNUC7421 zone)

EMBL: AP009493.PE705

AP009493.PE705       Location/Qualifiers
FT   CDS_pept        complement(834890..835636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_705"
FT                   /product="putative succinate dehydrogenase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_705"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17534"
FT                   /db_xref="GOA:B1VRW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW6"
FT                   /protein_id="BAG17534.1"
FT                   /translation="MKLTLRVWRQQNPETPGAMATYEVDNISADMSFLEMLDTLNEELT
FT                   LAGDEPVAFDHDCREGICGACSLVINGDAHGPERTTTCQLHMRSFADGDTIDIEPWRAS
FT                   AFPVIKDLVVDRSSFDRIIQSGGYISAPTGTAPDAHATPVPKPDADFAFEHAECIGCGA
FT                   CVAACPNGSAMLFTSAKVNHLNVLPQGAPERETRVLDMVAQMDEEGFGGCTLTGECATA
FT                   CPKGIPLPSIAAMNKEWLRATRKVRR"
     atgaagctca ccctgcgcgt ctggcgccag cagaaccccg agacgcccgg cgccatggcc        60
     acctacgaag tcgacaacat ctccgccgac atgtcgttcc tggagatgct cgacaccctc       120
     aacgaggaac tcaccctcgc cggggacgag cccgtcgcct tcgaccacga ctgccgcgag       180
     ggcatctgcg gcgcgtgcag cctcgtcatc aacggcgacg cccacggccc cgagcgcacc       240
     accacctgcc agctccacat gcgctccttc gccgacggcg acacgatcga catcgagccc       300
     tggcgggcct ccgccttccc ggtcatcaag gacctggtcg tggaccgctc ctcgttcgac       360
     cgcatcatcc agtccggcgg ctacatctcc gcccccaccg gcaccgcccc ggacgcccac       420
     gccaccccgg tgcccaagcc ggacgccgac ttcgccttcg agcacgccga gtgcatcggc       480
     tgcggagcct gcgtcgccgc ctgccccaac ggctcggcga tgctgttcac ctcggcgaag       540
     gtcaaccacc tcaacgtcct gccgcagggc gcgccggaac gcgagacccg cgtcctggac       600
     atggtggccc agatggacga ggagggcttt ggcggctgca ccctgaccgg cgagtgcgcc       660
     acggcctgcc ccaagggcat tccgctgccc tcgatcgccg cgatgaacaa ggagtggctg       720
     cgggcgaccc gcaaagtccg ccgctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page