(data stored in ACNUC7421 zone)

EMBL: AP009493.PE707

AP009493.PE707       Location/Qualifiers
FT   CDS_pept        complement(837584..838288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_707"
FT                   /product="putative cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_707"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17536"
FT                   /db_xref="GOA:B1VRW8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW8"
FT                   /protein_id="BAG17536.1"
FT                   /translation="MALATRTDRRPSMTRTLWDSTVGKKTIMAVTGLVMLGYLVAHMVG
FT                   NLKIFFGPGEFDGYAHWLRTMGEPVLHYEWALWLVRVGLVAAVVLHGVSAYQLSRRDIK
FT                   ARPAKYVHKKPRASYATRTMRWGGIILALFIVWHILDLTTGTVHTSFEAGHPYQNVIDT
FT                   FSTWYGNVIYIVAVLAMGLHVQHGFWSAAQTLGVGNATRDRILKTLANLLAAVLTVGFI
FT                   SVPVAVMTGVVS"
     atggcattgg caacgcggac ggaccgacgg ccgtcgatga cgcgtacgct ctgggactcg        60
     accgtcggca agaagacgat catggccgtg accggtctgg tcatgctcgg atatctcgtc       120
     gcccacatgg tgggcaacct gaagatcttc ttcggacccg gcgagttcga cgggtacgcc       180
     cactggctcc gcaccatggg cgaaccggta ctgcactacg agtgggcact gtggctcgtc       240
     cgggtggggc tggtcgcggc cgtcgtgctg cacggcgtct ccgcgtacca gctgagccgg       300
     cgcgacatca aggcgcgccc ggccaagtac gtccacaaga agccccgggc gagctacgcc       360
     acccgcacca tgcgctgggg cgggatcatc ctcgcgctgt tcatcgtctg gcacatcctc       420
     gatctgacga ccggcaccgt gcacaccagc ttcgaggccg gacaccccta ccagaacgtc       480
     atcgacacct tctcgacctg gtacggcaac gtcatctaca tcgtcgccgt gctcgccatg       540
     ggcctgcacg tccagcacgg tttctggagc gccgcgcaga ccctgggcgt cggcaacgcg       600
     acccgcgacc gcatcctgaa gaccctcgcc aacctcctcg cagcggtgct gacggtgggc       660
     ttcatctccg tacccgtcgc cgtcatgacc ggagtggtga gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page