(data stored in ACNUC7421 zone)

EMBL: AP009493.PE710

AP009493.PE710       Location/Qualifiers
FT   CDS_pept        complement(841492..842310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17539"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX1"
FT                   /protein_id="BAG17539.1"
FT                   /translation="MERPAWAPQGIDISVPSVSRMYDFYLGGSHNFEVDREAARKAMEF
FT                   LPGLPKIMQANRAFMRRAVRHAVDIGIDQFLDIGSGIPTFGNVHEVAQAADPGAKVAYV
FT                   DHDPVAVAHSQAVLEGNDRAVIAAADLRRPEEILANPEITGLLDLNRPVALLLVAVLHF
FT                   VEDADDPRGAVAELRESLAPGSLIVLTHASYEGIPLPKEEAAGTVGVYQNIRNPLIMRS
FT                   REEIGQFFEGYEMVEPGLVSMPEWRPDTPQAPQQEDPYAFSGFAGVGRKA"
     atggagcgtc ccgcctgggc accgcagggc attgacattt cggtgccaag cgtgtctcga        60
     atgtacgatt tctatctggg cggatcgcac aatttcgagg tggaccggga agccgcgcgc       120
     aaggccatgg agttccttcc gggccttccc aagatcatgc aggccaatcg cgcctttatg       180
     cgccgggccg tccgtcatgc cgtcgacatc ggcatcgacc agttcctgga catcggctcc       240
     ggcataccga ccttcggcaa cgtccacgag gtcgcccagg ccgccgaccc cggggccaag       300
     gtggcctacg tcgaccacga cccggtggcc gtcgcccaca gccaggccgt gctggagggc       360
     aacgaccgcg cggtgatcgc cgccgccgac ctgcgccgcc ccgaggagat cctggcgaac       420
     ccggagatca ccggactgct cgacctgaac cggccggtgg cgctgctgct ggtcgcggtc       480
     ctccacttcg tggaggacgc cgacgacccg cgcggcgcgg tcgccgagct gcgcgagtca       540
     ctggcccccg gcagcctgat cgtcctgacc catgcctcgt acgagggcat tccgctgccc       600
     aaggaggagg cggccggcac ggtcggcgtc taccagaaca tccgcaaccc gctgatcatg       660
     cgctcgcgcg aggagatcgg ccagttcttc gagggctacg agatggtcga accggggctc       720
     gtgtcgatgc ccgaatggcg gcccgacacc ccgcaggcgc cgcagcagga agacccgtac       780
     gccttctcgg gcttcgcagg ggttgggcgc aaggcgtga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page