(data stored in ACNUC7421 zone)

EMBL: AP009493.PE711

AP009493.PE711       Location/Qualifiers
FT   CDS_pept        843720..844484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_711"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_711"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17540"
FT                   /db_xref="GOA:B1VRX2"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX2"
FT                   /protein_id="BAG17540.1"
FT                   /translation="MSEWLVLSIAMASACAVVLTIAVLNNRRIADDDDPSETPDVIEYM
FT                   TMMIGVVYAIVLGLAIAGVWEGRSAAQESVRIEAQALHEVQARASVYPAEVRDRIRADV
FT                   DAYVDHVVHDEWKVMSDRNTLTERGTQLLDKVRADVTDYQPKTDHEGQAYQPLVDQVAA
FT                   ADDARSTRGQNAGATMPGVVWFGLIIGALVTVGLIFTLQIRRTFRELLLAGLFSALIAF
FT                   LLFLIWDFDAPFGRGISATADPFLDMFPGVAR"
     atgtccgaat ggctcgtact gagcattgcc atggcgtccg cctgcgcggt cgtcctcacc        60
     atcgccgtcc tgaacaaccg gcggatcgcg gacgacgacg acccgtccga gacgcccgac       120
     gtcatcgagt acatgacgat gatgatcggc gtggtctacg cgatcgtcct ggggctcgcc       180
     atcgccgggg tctgggaagg acgcagcgcc gcccaggagt ccgtacgcat cgaggcacag       240
     gccctgcacg aggtgcaggc gcgcgcctcc gtctacccgg cggaggtccg cgaccgcatc       300
     cgggcggacg tcgacgccta cgtcgaccac gtggtgcacg acgagtggaa ggtgatgtcc       360
     gaccggaaca cgctcaccga gcgcggcacg cagttgctgg acaaggtgag ggcggatgtc       420
     accgactacc aaccgaagac cgatcacgag gggcaggcct accagcccct ggtcgaccag       480
     gtggcggcgg ccgacgacgc ccgcagcacg cgcgggcaga acgccggggc gacgatgccg       540
     ggggtggtct ggttcgggct gatcatcggg gcgctggtga ccgtggggct gatcttcacc       600
     ctccagatcc gcagaacgtt ccgggaactg ctgctggccg gcctgttcag cgcgttgatc       660
     gccttcctgc tctttctgat ctgggacttc gacgcaccct tcggccgggg catctcggcc       720
     accgcggacc ccttcctcga catgttcccg ggcgtcgccc gctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page