(data stored in ACNUC7421 zone)

EMBL: AP009493.PE717

AP009493.PE717       Location/Qualifiers
FT   CDS_pept        complement(848363..849562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_717"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17546"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX8"
FT                   /protein_id="BAG17546.1"
FT                   /translation="MTLRIRPGTATAIALLLAAATGCTGQQPAAPDPTGPPGAARGAGG
FT                   QDAAGPRPFTLLAAGDILPHSSVIDRAAVDAGGAGYDFAPMLAGVAPVVSAADLAFCHM
FT                   ETVYGEEGGPYTGYPSFKSPPEVAAALRTTGYDSCSTASNHTLDDGAEGVSRTLAALDA
FT                   AGIRHAGSARTAAEAARPTILPAGPGENAARVAHLAYTYGTNDIPVPADRPWTVNVTDE
FT                   RKIVEEARAARRAGADVVVLSVHWGTEWQDEPDATQRDLAQRLTASAYGGRPDIDLIIG
FT                   THAHVPQAYEKVNGTWVVYGMGDQIAGAMINYEGVQDPRGNQGSMGRFTFAPPAKPGER
FT                   WTVKKAEFVPQWYDTDTGRTVNLNASPGDGDERLREIRDRIRTVVLGRGAEGDGLLMGR
FT                   "
     atgacgctgc gcatccgacc gggcaccgcg accgccatcg ccctcctgct cgccgctgcc        60
     accggctgca ccgggcagca gcccgccgcc cccgacccga ccgggccgcc cggggcggcc       120
     cggggcgccg gcggccagga cgccgcgggg ccccgcccgt tcacgctcct cgccgcgggc       180
     gacatcctgc cgcactcctc cgtgatcgac cgggccgctg tcgacgcggg cggcgcgggc       240
     tacgacttcg ccccgatgct ggcgggcgtc gccccggtcg tctccgccgc ggacctggcg       300
     ttctgccaca tggagacggt gtacggcgag gagggcggcc cctacaccgg ctaccccagc       360
     ttcaagtcgc ccccggaggt cgccgcggcc ctgcgcacca ccgggtacga ctcctgctcc       420
     accgcctcca accacaccct cgacgacggg gccgaggggg tctcgcgcac cctcgccgcg       480
     ctggacgcgg cgggcatccg gcacgccggc tccgcccgta ccgcggccga ggccgcccgg       540
     cccacgatcc tgcccgccgg gccgggcgag aacgcggcca gggtcgccca cctcgcgtac       600
     acctacggca ccaacgacat cccggtcccc gccgaccggc cctggacggt caacgtcacc       660
     gacgagcgga agatcgtcga ggaggcgagg gcggcccggc gggccggcgc cgacgtcgtc       720
     gtcctctccg tccactgggg caccgaatgg caggacgagc ccgacgcgac ccaacgggac       780
     ctggcccagc ggctcaccgc gtccgcctac gggggccgcc ccgacatcga cctgatcatc       840
     ggcacccacg cgcatgtgcc gcaggcgtac gagaaggtca acggcacctg ggtcgtctac       900
     gggatgggcg accagatcgc cggagcgatg atcaactacg agggcgtcca ggacccgcgc       960
     ggcaaccagg gttcgatggg acgcttcacc ttcgcgccgc ccgcgaagcc gggggagcgc      1020
     tggacggtga agaaggcgga gttcgtcccg cagtggtacg acaccgacac cggacgcacc      1080
     gtcaacctca acgcctcccc gggcgacggg gacgagcgcc tccgcgagat ccgcgaccgt      1140
     atccgtacgg tggtcctcgg gaggggagcg gagggcgacg ggctcctcat gggccggtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page