(data stored in ACNUC7421 zone)

EMBL: AP009493.PE719

AP009493.PE719       Location/Qualifiers
FT   CDS_pept        850646..851149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_719"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_719"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17548"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY0"
FT                   /protein_id="BAG17548.1"
FT                   /translation="MRPEDTDGTGGNGLQVPMNWLSTEYLADDLLRTGDLMEPTTLEFR
FT                   AGRDALALTMFLCGVPRDAPSSRALPGPRVDELRILTAYECTWRAWICERLAEAERNTA
FT                   PGDPDLALARAAWRWLEETELLAADLDAIGPAPWDAADDQEVRVWTPAWQLGLPLGHLA
FT                   VHLC"
     atgcgtcccg aggatacgga tgggaccgga gggaacgggc tccaggtacc gatgaactgg        60
     ttgtccacgg agtatctcgc cgatgacctg ttacggaccg gcgatctgat ggaaccgacg       120
     accctggagt tccgggcggg gcgcgacgcc ctcgcgctga cgatgttcct gtgcggagta       180
     ccccgggacg cgccctcctc gcgggccctg ccgggaccgc gcgtcgacga gctgcggatc       240
     ctcacggcgt acgagtgcac ctggcgcgcc tggatctgcg agcggctggc cgaggcggaa       300
     cggaacaccg cgccgggcga ccccgatctg gcgctggcgc gggcggcctg gcggtggctg       360
     gaggagaccg agctgctcgc ggcggacctc gacgcgatcg gccccgctcc gtgggacgcc       420
     gcggacgatc aggaggtcag ggtctggacg cccgcctggc agctggggct gccgctgggg       480
     catctggccg tccacctgtg ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page