(data stored in ACNUC7421 zone)

EMBL: AP009493.PE72

AP009493.PE72        Location/Qualifiers
FT   CDS_pept        76808..77086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_72t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_72t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16901"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM00"
FT                   /protein_id="BAG16901.1"
FT                   /translation="MRRGVYQFNPPYSYRVAEFLPGTELVEAEYVQVDQDKTIAKIRRD
FT                   ESLPDLVRFPSLDHMREAIEELRKKRAEDRAARRLARAQRQEEGSAQ"
     ttgcgccgcg gtgtctacca gttcaacccg ccctactcgt accgcgtagc ggagttcctc        60
     ccgggcacgg agctcgtcga agccgagtac gtgcaggtcg atcaggacaa gacgatcgcg       120
     aagatccgca gggacgagag ccttccggac ctggtgcggt tcccgtcgct ggaccacatg       180
     cgcgaagcta tcgaggaact gcggaagaag cgggccgagg accgcgctgc acgccgattg       240
     gcccgggcgc agcgccagga ggagggatca gcccagtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page