(data stored in ACNUC7421 zone)

EMBL: AP009493.PE722

AP009493.PE722       Location/Qualifiers
FT   CDS_pept        complement(853848..854210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_722"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_722"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17551"
FT                   /db_xref="GOA:B1VRY3"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY3"
FT                   /protein_id="BAG17551.1"
FT                   /translation="MSAEPSPRREVVTGEPRRVRPLPRYRTQAEIDEQTALGGAYVRSL
FT                   MRGQLRAGLTVFGVLALVAGTLPLLFAALNSSALVWAVLGFATYPPLTLAAWWYVRRAE
FT                   RNERDFARLVEGRPAP"
     atgtccgcag agccatcgcc ccggcgcgaa gtggtcacgg gggagccgcg ccgggtgcgc        60
     ccgctgcccc gctaccgcac ccaggcggag atcgacgagc agaccgcact cggcggcgcc       120
     tacgtacgct cgctgatgcg cggccaactg cgcgccgggc tcaccgtctt cggcgtcctc       180
     gccctcgtcg cgggcaccct gccgctcctg ttcgccgcgc tgaacagctc cgccctcgtc       240
     tgggcggtgc tcggcttcgc gacctacccg ccgctcaccc tggccgcctg gtggtacgtc       300
     cgccgggccg agcgcaacga acgcgacttc gcccggctgg tggagggccg ccccgccccg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page