(data stored in ACNUC7421 zone)

EMBL: AP009493.PE725

AP009493.PE725       Location/Qualifiers
FT   CDS_pept        complement(856075..857454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_725"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17554"
FT                   /db_xref="GOA:B1VRY6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY6"
FT                   /protein_id="BAG17554.1"
FT                   /translation="MRPPLGTELLAPLDLAFWHLESDAHPMHLGALAVFAPAPGAAPER
FT                   ILHVLATRAAAVPRLRMRVRDVLLPVGGKAWTADKDFDVRRHISHVVVDDGDFMAQAGR
FT                   LAGELMERPLGRGLPPWRMYLIGGPAGGPFAVLVKLHHALADGMRAVAIGAGIFDEIAA
FT                   VAGARTTARGRPAVPPRSWPPDPRAMAGLALGRIGEVGRALGVGASVVRAGRLGPRSTT
FT                   AFTAPSSGTRRLATADLDAGRLKRIRRAEGGTANDILLAVVAGALRRWMAERAEPLPAA
FT                   DPRALVPVSRRRPGVATASGNRLSAYLLDLPVTEPDPLARLRAVREAMDRNKAAGPLRG
FT                   AGAVAVLADQLPPLAHRFGAPLAANAARVLFDLLVTSVPLPRSALSLDGCPLTALYPMA
FT                   PLARGQSLAVALSTYGGRVHVGLVADGKALPDLDRLAAAVEEEFTQLGAALTGTDRVPV
FT                   P"
     atgaggcccc cgttgggtac cgagctcctc gccccgctcg atctcgcttt ctggcacctc        60
     gaatcggacg cgcatccgat gcacctcggc gcgctcgccg tcttcgcgcc ggcgcccggc       120
     gccgctccgg agcggatcct ccacgtgctg gccacccgcg ccgccgccgt cccccggctg       180
     cggatgcgcg tacgggacgt cctgctgccg gtcggcggca aggcctggac ggcggacaag       240
     gacttcgacg tgcggcggca catcagccac gtcgtcgtgg acgacggcga cttcatggcg       300
     caggccggcc gactggccgg cgaactgatg gagcgaccgc tcgggcgcgg gctgccgccc       360
     tggcggatgt atctcatcgg cggcccggcc ggcggcccct tcgccgtcct ggtcaaactg       420
     caccacgccc tggccgacgg gatgcgggcg gtcgccatcg gggccgggat cttcgacgag       480
     atcgccgccg tcgccggcgc ccgcaccacg gcccggggcc gccccgccgt cccgccccgc       540
     tcctggccgc ccgacccccg ggcgatggcg ggcctggccc tcggccggat cggcgaggtc       600
     ggcagggccc tcggcgtggg cgcctccgtc gtccgggccg gccgcctcgg cccgcgctcc       660
     acgacggcct tcaccgcacc ctccagcggc acccgcaggc tggccaccgc cgacctcgac       720
     gccgggcgtc tgaagcgcat ccggcgcgcc gagggcggca ccgccaacga catcctcctc       780
     gccgtcgtcg ccggtgcgct gcgccgttgg atggcggagc gggccgaacc gctgcccgcc       840
     gccgatccgc gcgccctggt ccccgtctcc cgccgccggc ccggcgtggc caccgcctcc       900
     gggaaccggc tctccgccta tctgctcgac ctgccggtca ccgagcccga cccgctcgcc       960
     cggctgcggg cggtccggga ggcgatggac cgcaacaagg cggccggccc cctgagaggc      1020
     gccggagccg tcgccgtact ggccgaccaa ctgcccccgc tggcccaccg gttcggcgca      1080
     ccactggcgg ccaacgcggc ccgcgtgctg ttcgacctgc tggtcaccag cgtgcccctg      1140
     ccccgctccg cgctctcgct ggacggctgc ccgctgaccg ccctctaccc catggcgccc      1200
     ctggcccgtg gccagtccct ggccgtcgcc ctctccacct acggaggccg ggtgcacgtg      1260
     ggactggtgg ccgacggcaa ggcgctgccc gacctcgacc ggctcgccgc cgccgtggag      1320
     gaggagttca cgcagctggg cgccgccctc accggcacgg accgcgtacc ggtgccctga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page