(data stored in ACNUC7421 zone)

EMBL: AP009493.PE726

AP009493.PE726       Location/Qualifiers
FT   CDS_pept        complement(857565..859628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_726"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17555"
FT                   /db_xref="GOA:B1VRY7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY7"
FT                   /protein_id="BAG17555.1"
FT                   /translation="MDDRVAGALSLPDDWPAHPDLSLALNRMGSFDWDLDTGLMHMDRT
FT                   ALDVFDLTEDEYDDRPDSLAPRVPTDEAQRLDALVSHALKSGRTEYGAYFRIQRRDGTL
FT                   RWTHTQGFVRRDGAGRPHRIIGIVRDATQELADSTARRELDEDRRRRTSLVEGTTAALA
FT                   HARTVKDVIAVLKNSQGLAHLGATSLVMGLLESGRIHLVADGPKGSYVPGTRYTRVDEQ
FT                   YPMSEVVRTLTPRFIESADDFATSYPILWRDISHLEITSAAYMPLIAQARPIGALGLLY
FT                   RDKGGFTEDERNLLMALGTSIAQSLQRAMLYEQEHDLAEGLQQAMLPRRIPAVPGAQVA
FT                   VRYRSARLGRDIGGDWYDLIPLPGGRVGAVIGDVQGHDTHAAAVMGQLRIVLRAYAAEG
FT                   HSPATVMARASVFLHELDTDRFATCTYAEVDLTTGVVQLVRAGHVDPLVRDVDGSCRRM
FT                   PSEGGLPLGLSAEFGRLEYPVGTVELDPGQTMVLFTDGLVELPGSDLDEGMQHLTALVT
FT                   NGPRDLQELADRLCDTVDERGGQDDVAVLLLRRRAAQAPQPGGRLQQHVAQNDPEALRS
FT                   SRHMIRAAVRAWGAKDRADEIELAADELITNALMHTDGGAVVTIRVLAGPERRLRVDVE
FT                   DRSSALPRRRDAGESGVSGRGLMLVDRLADVWGVESRGSGKCVWCEFLIPAR"
     atggatgatc gggtagcggg tgccctgtcg ctccccgacg actggcccgc ccacccggac        60
     ctcagcctcg ccctgaaccg tatgggcagc ttcgactggg atctcgacac cggcctcatg       120
     cacatggacc ggaccgccct cgacgtgttc gacctgaccg aggacgaata cgacgaccgg       180
     ccggactcgc tggcgccgcg cgtgccgacg gacgaggccc agcggctgga cgcgttggtc       240
     tcccacgccc tcaagagcgg gcgcaccgag tacggcgcct acttccgcat ccagcggcgg       300
     gacggcacgc tgcgctggac ccacacccag ggcttcgtcc gccgggacgg cgccggccgc       360
     ccccaccgca tcatcgggat cgtccgcgac gccacccagg agctcgccga ctccaccgcc       420
     cggcgcgagc tggacgagga ccgccgccgc cgcaccagcc tggtcgaggg caccacggcg       480
     gcgctggccc acgcccgtac ggtcaaggac gtcatcgccg tcctcaagaa ctcccagggg       540
     ctcgcccacc tcggcgccac cagcctcgtc atgggcctcc tggagtccgg ccgcatccac       600
     ctcgtggccg acggccccaa gggctcctac gtccccggca cccgttacac ccgggtggac       660
     gagcagtacc cgatgagcga ggtggtgcgc accctgaccc cccggttcat cgagtccgcc       720
     gacgacttcg ccacctccta cccgatcctg tggcgcgaca tcagccacct cgagatcacc       780
     tccgccgcct acatgccgct gatcgcgcag gcccgcccga tcggcgcgct cggcctcctc       840
     taccgggaca agggaggctt caccgaggac gaacgcaatc tgctgatggc actcggcacc       900
     tcgatcgccc agagcctcca gcgcgcgatg ctctacgaac aggagcacga tctcgccgag       960
     ggcctccagc aggcgatgct gccccgtcgg atcccggccg tgcccggggc gcaggtcgcc      1020
     gtccgctacc gctcggcccg tctgggccgg gacatcggcg gtgactggta cgacctgatc      1080
     ccgctgcccg gcggccgggt cggcgccgtc atcggcgacg tccaggggca cgacacccac      1140
     gccgccgccg tcatggggca gctcaggatc gtcctgcgcg cgtacgccgc cgaggggcac      1200
     agccccgcca cggtcatggc gcgggcctcc gtcttcctcc acgaactgga caccgaccgc      1260
     ttcgccacct gcacctacgc cgaggtcgac ctcaccaccg gcgtcgtgca gctggtccgc      1320
     gccggacacg tggacccgct ggtgcgggac gtggacggga gctgccgcag gatgccgtcc      1380
     gagggcgggc tgccgctcgg cctctcggcc gagttcggcc ggctggagta cccggtcggc      1440
     acggtcgaac tggaccccgg ccagacgatg gtcctgttca ccgacggtct cgtcgaactg      1500
     ccgggctccg acctcgacga aggcatgcag cacctcaccg ccctcgtcac caacggcccc      1560
     cgggacctcc aggaactggc cgaccggctc tgcgacaccg tcgacgaacg cggcggccag      1620
     gacgacgtcg ccgtcctgct gctgcgccgc cgggccgcgc aagcccccca gccgggcggc      1680
     cgcctccagc agcacgtcgc ccagaacgac cccgaggcgc tgaggtcgtc ccggcacatg      1740
     atccgggcgg ccgtccgggc ctggggggcg aaggaccgcg ccgacgagat cgaactcgcg      1800
     gccgacgagc tgatcaccaa cgcgctcatg cacaccgacg gcggcgccgt cgtgacgatc      1860
     cgggtgctcg ccgggcccga gaggcggctg cgcgtcgacg tcgaggaccg ctccagcgca      1920
     ctgccccggc gccgcgacgc gggggagtcg ggagtgtcgg gacgcggcct gatgctggtc      1980
     gaccggctgg ccgacgtctg gggcgtggaa tcccgcggca gcggcaaatg cgtgtggtgc      2040
     gagttcctca ttccggcccg ctga                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page