(data stored in ACNUC7421 zone)

EMBL: AP009493.PE727

AP009493.PE727       Location/Qualifiers
FT   CDS_pept        complement(859755..860861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_727"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17556"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY8"
FT                   /protein_id="BAG17556.1"
FT                   /translation="MRSPRHVRRTALAALSAGVLLAVAGCGGGGDRTAKGTTGTAEAKD
FT                   VLLQPLASPGPGPFTASTALTAASPSPTGGPDADPTSATRTVHRVSGAVPGLYGGTRSV
FT                   AACDVEQQASLLAGDEDKARAFAGASGIEAVQIPGYLKSLTPVVLRADAQVTSHGYSAG
FT                   SATAFQAVLQAGTAVLVDSRGMPRVRCACGNPLAPPVVADGEVAHRGERWPGYDPARVL
FT                   AVEPGVKAATSLIIVNTDDNTWIERAMGDSGGRDRTPDDPPPFEPDADLLFPSPGRPTE
FT                   SAPPDTAPTGPAPSEPQEPTDPGAPEPSDDFGDTPPEEPWEYEEGDPDVAPEPTQVFPA
FT                   EPDGPPEPEAPAAPDEPMEAGLDDVFAG"
     gtgcgctcac ccagacatgt ccggcgtacc gcgctcgccg cgctgtccgc cggagtgctg        60
     ttggccgtcg ccggctgcgg aggcggcggg gaccgtacgg cgaagggcac cacgggcacc       120
     gcggaggcca aggacgtcct cctccagccg ctcgcctccc ccggccccgg tccgttcacc       180
     gcttccacgg cgctgacggc ggcctccccg tcccccaccg gtggcccgga cgccgatccc       240
     acctccgcca cccggacggt ccatcgggtc tccggcgccg tgccggggct ctacggcggc       300
     acccgctcgg tcgccgcctg cgacgtcgaa cagcaggcct ccctcctggc cggcgacgag       360
     gacaaggccc gcgccttcgc cggcgcgtcc ggcatcgagg ccgtacagat ccccggctac       420
     ctgaagtccc tcaccccggt cgtcctgcgc gccgacgccc aggtcaccag ccacggctac       480
     agcgccggct cggccaccgc cttccaggcc gtgctccagg cgggcaccgc cgtcctggtc       540
     gacagccgcg ggatgccccg tgtccgctgc gcctgcggca acccgctggc cccgccggtg       600
     gtcgccgacg gggaggtcgc ccaccggggc gagcgctggc ccggctacga ccccgcgcgc       660
     gtcctggccg tcgagcccgg cgtcaaggcg gccaccagcc tcatcatcgt gaacaccgac       720
     gacaacacct ggatcgagcg ggccatgggc gacagcggcg gacgcgaccg caccccggac       780
     gacccgccgc ccttcgagcc cgacgccgac ctgctgttcc cctcgccggg acgccccacc       840
     gaatccgcgc ccccggacac cgccccgacc gggccggccc cctccgagcc gcaggagccc       900
     acggaccccg gagcgccgga gccgtccgac gacttcggcg acacgccgcc cgaggagccg       960
     tgggagtacg aggaggggga cccggacgtc gcgccggagc cgacccaggt cttccccgcc      1020
     gagccggacg gcccgcccga gccggaagcg cccgccgcgc cggacgagcc catggaggcg      1080
     ggcctcgacg acgtgttcgc cggctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page