(data stored in ACNUC7421 zone)

EMBL: AP009493.PE728

AP009493.PE728       Location/Qualifiers
FT   CDS_pept        861031..861891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_728"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17557"
FT                   /db_xref="GOA:B1VRY9"
FT                   /db_xref="InterPro:IPR025450"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY9"
FT                   /protein_id="BAG17557.1"
FT                   /translation="MSALVNAVVMLGMLVIVPTGLRLAERPELDLLRRLWPLFAVPGSV
FT                   ALWLPRGATATALACCYALGTVVLALHAPRRAVRGGHLDPAGIALLTALVTPAVAGVAL
FT                   VAERSGHELFGFDLGILALTVPHFHFAGFAAALVAGLVCRVSDGPAGRFAALSVPLGTL
FT                   LVLVGYFVGDWAELAGALVLTAGMWTVGLLTWRTGLAEGRDRTTRLLLLASAAVLVATM
FT                   LLALSWALGEATGLPHPSLTWMAATHGLGNALGFALCSLLAWRRIRTEEPDRTAGTDRT
FT                   GGRTA"
     atgtccgcac tggtcaacgc cgtcgtgatg ctgggcatgc tcgtcatcgt gccgacaggg        60
     ctgcggctgg ccgagcgacc ggaactggac ctcctccgcc ggctctggcc cctcttcgcc       120
     gtcccgggct ccgtcgccct gtggctgccg cgcggagcca ccgccacggc gctcgcctgc       180
     tgttacgcgc tggggaccgt cgtactcgcc ctccacgcac cgcgccgggc ggtccgcggc       240
     ggtcacctcg acccggctgg gatcgcgctg ctcaccgcgc tggtcacccc cgccgtcgcc       300
     ggggtcgccc tggtcgccga acgctcgggg cacgagctgt tcggcttcga cctcggcatc       360
     ctggcgctga ccgtgccaca cttccacttc gccgggttcg ccgccgccct ggtcgccggg       420
     ctcgtctgcc gggtctccga cggcccggcg ggccgtttcg ccgcgctgag cgtgccgctc       480
     ggcaccctgc tcgtcctcgt cggctacttc gtcggcgact gggcggagct ggccggggcg       540
     ctcgtcctca cggccggcat gtggacggtc ggcctgctga cctggcgcac ggggctcgcc       600
     gaaggccgcg accggacgac ccggctcctg ctgctcgcgt ccgccgccgt cctggtggcg       660
     acgatgctgc tcgcactgag ctgggcgctg ggcgaggcga ccggactgcc ccacccctcc       720
     ctgacctgga tggccgccac ccacggtctg ggcaacgcgc tgggcttcgc gctctgctcg       780
     ctgctggcct ggcgccgcat ccgcaccgag gaacccgacc gcaccgcagg aaccgaccgc       840
     accggaggca ggaccgcatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page