(data stored in ACNUC7421 zone)

EMBL: AP009493.PE729

AP009493.PE729       Location/Qualifiers
FT   CDS_pept        861888..862400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_729"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_729"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17558"
FT                   /db_xref="InterPro:IPR014457"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ0"
FT                   /protein_id="BAG17558.1"
FT                   /translation="MSTLTYPEVGATRLGPLPRGYHHLHHRTRIGRGEADFATAGAAVT
FT                   EWRMHRASGARVESPAPRAEPGGGVRVSLGLGPLRFTAPCQVIWAEYGEDGRTGFGYGT
FT                   LAGHPERGEECFTVDLADDGTVWFTVLAFSRPASWYTRLAGPLVPVVQHWYARRLGRTL
FT                   RRIVAAS"
     atgagcaccc tcacctaccc ggaggtcggc gcgacccgcc tcggcccgct cccccggggc        60
     taccaccacc tccaccaccg cacccggatc ggccggggcg aggcggactt cgccaccgcc       120
     ggagcggcgg tgaccgaatg gcggatgcac cgtgcctcgg gcgcgcgggt ggagtccccg       180
     gcaccacgcg cggagccggg cggcggcgtc cgggtctcgc tcggcctcgg gccgctgcgc       240
     ttcacggccc cctgccaggt catctgggcg gagtacgggg aggacggacg caccggcttc       300
     ggttacggca ccctcgccgg ccatccggag cgcggcgagg agtgcttcac ggtggatctc       360
     gcggacgacg gcaccgtgtg gttcacggtg ctggcgttct cgcgccccgc gtcctggtac       420
     acgcgcctgg ccggaccgct ggtgcccgtc gtccagcact ggtacgcccg taggctcggc       480
     cgtacgctgc gccggatcgt cgccgcgagc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page