(data stored in ACNUC7421 zone)

EMBL: AP009493.PE73

AP009493.PE73        Location/Qualifiers
FT   CDS_pept        77208..77567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_73t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_73t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16902"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM01"
FT                   /protein_id="BAG16902.1"
FT                   /translation="MDQGTLGKLLGLSRPSVNAALRELELELELAKLVRKVRNGVYQIN
FT                   PMLAGYDCPEDALDAVKAMPRADRLDSKTYVSDYHRAVAAYQDQLAEQRKKRAAAAAAK
FT                   KAAATRRRGSLHAVG"
     atggatcagg gcaccctcgg gaagctcctc ggtctcagcc gccccagcgt gaacgctgct        60
     ctgcgggagc tggagctgga gctggagctg gccaagctcg tcaggaaggt ccgtaacggc       120
     gtctaccaga tcaacccgat gctggcgggc tacgactgcc ccgaggacgc gttggacgcc       180
     gtgaaggcga tgccgagggc cgaccggctc gacagcaaga cctacgtatc ggactaccac       240
     cgggccgtcg ccgcgtacca ggaccagctg gccgagcagc gcaagaagcg tgccgccgct       300
     gccgccgcga agaaggccgc ggccaccagg aggcgcggct cgctccacgc cgtcggctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page