(data stored in ACNUC7421 zone)

EMBL: AP009493.PE730

AP009493.PE730       Location/Qualifiers
FT   CDS_pept        862459..863904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_730"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17559"
FT                   /db_xref="GOA:B1VRZ1"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ1"
FT                   /protein_id="BAG17559.1"
FT                   /translation="MEWFTADGYWLSRLIFQRALAVVYLVAFLSAALQFRALIGERGML
FT                   PVPELLRRTPWRAAPGIFRLHYSDRFFAAVACSGCAVSVALIAGLDGLLPLWGGMLLWA
FT                   LPWLLYLSIVQVGQVWYGFGWESLLLETGFLAVFLGSGDTGAPVLVLWLLRWLLFRVEF
FT                   GAGLIKVRGDACWRKLTCLDFHHETQPMPGPLSWFFHHLPRPVHRVEAAANHLTQLVVP
FT                   FALFTPQPVASAAAGLMVLTQLWLVLSGNFAWLNWLTIALALSAIDWTPLAGPPPPQVA
FT                   PPLWYGVVVVAATALVLVLSYRPVRNLLSRRQAMNRSYDPLHLVNSYGAFGSISRTRLE
FT                   VVVEGSADPVEREGAEWREYGFRGKPGDPRRLPRLYAPYHLRLDWMMWFAALSPAYARP
FT                   WFGAFAERLLDGDRDTLRLLGHDPFPDGPPRQVRARVFRYRFTGLRELRATGCWWHRTY
FT                   VREFLRPVSRPLPPERETGRRTR"
     atggaatggt tcaccgcgga cggctactgg ctgagccggc tgatcttcca gcgggctctg        60
     gccgtggtct atctggtcgc cttcctctcc gccgcgctcc agttccgggc gctgatcggc       120
     gagcgcggca tgctgcccgt ccccgagctg ctgcggcgca cgccctggcg cgccgccccg       180
     gggatcttcc ggctgcacta ctcggaccgc ttcttcgccg cggtcgcctg cagcggctgc       240
     gccgtctcgg tggctctgat cgccggtctc gacgggctgc tgccgctgtg gggcggcatg       300
     ctgctctggg cgctgccgtg gctgctctat ctgtcgatcg tccaggtggg gcaggtctgg       360
     tacggattcg gctgggagtc gctgctgctg gagacggggt tcctcgcggt cttcctcggc       420
     tccggggaca cgggcgcccc ggtgctggtg ctgtggctgc tgcggtggct gctgttccgg       480
     gtggagttcg gcgcggggct gatcaaggtg cgcggggacg cctgctggcg gaagctgacc       540
     tgcctggact tccaccacga gacgcagccg atgccggggc cgctgagctg gttcttccac       600
     catctgcccc ggcccgtgca ccgggtggag gccgccgcca accacctcac ccagctggtg       660
     gtgcccttcg ccctgttcac cccgcagccg gtggcgagcg cggcggccgg actgatggtc       720
     ctcacccagc tctggctcgt cctgtcgggg aacttcgcct ggctgaactg gctcaccatc       780
     gcgctggcgc tctccgcgat cgactggact cccctggccg ggccgccgcc cccgcaggtc       840
     gcgccgcccc tctggtacgg ggtggtggtc gtcgcggcga ccgccctggt cctcgtgctc       900
     agctaccgcc cggtgcgcaa tctgctctcc cggcggcagg cgatgaaccg gtcctacgac       960
     cccctgcacc tggtcaactc ctacggggcg ttcggttcca tcagccggac gcggctggag      1020
     gtcgtggtcg aggggagcgc cgatccggtg gagcgcgagg gggccgagtg gcgggagtac      1080
     ggcttccgcg gcaagccggg cgatccacgg cggctgccgc gcctgtacgc cccctaccat      1140
     ctgcggctcg actggatgat gtggttcgcg gcgctctccc ccgcttacgc ccgcccctgg      1200
     ttcggcgcct tcgccgagcg gctgctggac ggcgaccggg acacgctccg gctgctcggg      1260
     cacgatccgt tccccgacgg accgccccgg caggtgcgcg cccgggtgtt ccgctaccgg      1320
     ttcaccgggc tccgggagct gcgggccacc ggatgctggt ggcaccgcac ctatgtccgg      1380
     gaattcctgc ggcccgtctc ccggccgctg ccgccggagc gggagacggg ccgcaggacg      1440
     cgctga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page