(data stored in ACNUC7421 zone)

EMBL: AP009493.PE731

AP009493.PE731       Location/Qualifiers
FT   CDS_pept        complement(863930..864106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_731"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17560"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ2"
FT                   /protein_id="BAG17560.1"
FT                   /translation="MTTPELTERDMRPADRIAGRPGRPEKLRNIEVWARSAPIRLAGYE
FT                   DDLAEPHILPGID"
     gtgacgacac ctgaactgac cgagcgcgac atgcgccccg ccgatcggat cgcggggcgg        60
     cccggccgcc ccgagaagct gcggaacatc gaggtctggg ccaggtccgc cccgatccgg       120
     ctcgccggat acgaggacga cctcgccgag ccgcacatcc tgcccggcat cgactga          177
//

If you have problems or comments...

PBIL Back to PBIL home page