(data stored in ACNUC7421 zone)

EMBL: AP009493.PE734

AP009493.PE734       Location/Qualifiers
FT   CDS_pept        867320..868576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_734"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_734"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17563"
FT                   /db_xref="GOA:B1VRZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ5"
FT                   /protein_id="BAG17563.1"
FT                   /translation="MGTSPIPVGIPGIPTQQVGIPHRPESPLWNLDASILLVEDDAGDA
FT                   LLVEEMLTDSELDSALTWCKTLTEARAFLSTATTPVCVLLDLHLPDAHGLDAVRQILES
FT                   DSDAAIVVLTGLEESGTGLRAVAQGAQDYLVKGRLGPEVLSRAVRYALQRKEVERAAAA
FT                   LRANQLIAQENARLELGLLPVPLLRDDRFRARARYEPGRVHGLLSGDFYDVVQTADGTV
FT                   HAVIGDVSGHGAAEAALGVCLRVAWRTAVLCGTSQPEQIALLEEILVAERSDSHVFATV
FT                   TSLVFPPGQRHAQVLRAGHPGLLLREGKDVSWVEPEGGMALGLLPGFGRWPTVDIPLAP
FT                   GAGLVLFTDGLFEGRDGPDSRLGEEGLLAMARANGHLPARSFVDALVAGAAEGAAPYGG
FT                   LADDVAVLHLGWGSESDER"
     gtgggcacat ctccgatccc tgtgggcatc cccggcatcc ccacccagca ggtcggcata        60
     ccccaccgcc ccgagtcccc gctgtggaac ctcgacgcgt cgatcctgct cgtggaggac       120
     gacgcgggcg acgcgctgct cgtcgaggag atgctcaccg acagcgagct ggactccgcc       180
     ctcacctggt gcaagacgct gaccgaggca cgcgccttcc tgagcacggc caccaccccg       240
     gtgtgcgtgc tcctggacct gcacctgccc gatgcccacg ggctggacgc ggtgcgccag       300
     atactggaat cggacagcga cgccgccatc gtcgtcctca ccggcctgga ggagtccggc       360
     accgggctcc gcgcggtcgc ccagggcgcc caggactacc tggtgaaggg ccgcctcggc       420
     ccggaggtgc tctcgcgcgc ggtccgctac gccctgcagc gcaaggaagt ggaacgggcc       480
     gcggccgcgc tgcgcgccaa tcagctgatc gcccaggaga acgcccgcct ggagctcggg       540
     ctgctgcccg tccccctgct gcgggacgac cgcttccggg cgcgcgcacg ctacgagccc       600
     gggcgggtcc acgggctgct gagcggtgac ttctacgacg tcgtacagac ggcggacggc       660
     acggtccacg cggtgatcgg cgatgtgtcc gggcacggcg cggccgaggc ggcgctcggt       720
     gtgtgtctgc gggtggcctg gcgtaccgcc gtgctgtgcg gtacgtccca gcccgagcag       780
     atcgccctgc tggaggagat cctggtcgcg gagcgctcgg actcgcacgt gttcgccacc       840
     gtcacctcgc tggtgttccc gcccgggcaa cggcacgcgc aggtcctgcg ggccggtcat       900
     cccggcctgc tgctgcgtga gggcaaggac gtgtcctggg tcgagcccga gggcggcatg       960
     gccctcgggc tgctgcccgg gttcggccgg tggccgacgg tcgacatccc gctggcgccc      1020
     ggtgcgggtc tcgtactctt cacggacggg ctcttcgagg ggcgtgacgg acccgacagc      1080
     cgtctcggcg aggaggggct gctcgcgatg gcccgggcca acgggcatct gccggcccgc      1140
     tcgttcgtcg acgccctggt cgcgggggcc gcggaggggg ccgcccccta cggcggtctc      1200
     gcggatgacg tggccgttct gcatcttggc tggggatccg aatccgatga gcggtga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page