(data stored in ACNUC7421 zone)

EMBL: AP009493.PE735

AP009493.PE735       Location/Qualifiers
FT   CDS_pept        868578..870197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_735"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_735"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17564"
FT                   /db_xref="GOA:B1VRZ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ6"
FT                   /protein_id="BAG17564.1"
FT                   /translation="MTKQPAPGGFAARLSVQNWVHLILGGFIVVVCACLVIGGLVMARI
FT                   SDRTTELVDRIQPARSASFQLQNALLDQETGIRGFALTGDDSFLEPYEAGKAAEQERLA
FT                   QVRRLVGSGGRYADDLDAIAAAAEQWRRSKAEPLIATVREQGPSEAATSARLQRSKADF
FT                   DQLRQAYGAQQGHLAEARDRARADLGSARTTRDQVMIALVTVFVLTVAALSLLLHRVVG
FT                   VPLTRLRTASDRVRSGAFGTRIEINGPSDVQAVARTVEDMRRRLADELSEAQSREALLA
FT                   EQTDELRRSNSELEQFAYVASHDLQEPLRKVASFCQLLEKRYGKELDDRGKQYIAFAVD
FT                   GAKRMQVLINDLLTFSRVGRVQEGWKPVDLDRSLDRALGNLAVAIEESGTVIERPESLP
FT                   ELLGDATALTMVWQNLVGNAVKFRREGVPCRISVTCVQEGEDWHLTVSDNGIGIAPEFA
FT                   DKVFVIFQRLHARDEYDGTGIGLALCRKIIEFHGGRIWLEPEPGEGTRFHFTLPVAPEA
FT                   PTHTAAELLAPALLTSQPGDPS"
     atgacgaaac aaccggcccc gggcggcttc gccgcgcggc tgtccgtaca gaactgggtc        60
     cacctcatac tcggcggatt catcgtggtg gtctgcgcct gtctggtgat cggcgggctc       120
     gtgatggccc ggatctccga ccgtacgacc gagttggtgg accgcatcca gcccgccagg       180
     tccgcgtcct tccagctcca gaacgccctg ctggaccagg agaccgggat cagggggttc       240
     gcgctgaccg gcgacgactc cttcctcgaa ccgtacgagg cggggaaggc cgccgagcag       300
     gagcgtctcg cccaggtccg gcggctggtg ggctccggcg gccggtacgc cgacgacctc       360
     gacgccatcg ccgccgccgc cgagcagtgg cggcggagca aggccgagcc cctgatcgcg       420
     acggttcgcg agcaggggcc gagcgaggcc gccacctccg cccggttgca gcgcagcaag       480
     gcggacttcg accagctgcg gcaggcgtac ggcgctcagc agggccatct cgccgaggcc       540
     cgcgaccggg cccgcgccga cctcggatcg gcgcgcacca cccgcgacca ggtgatgatc       600
     gccctggtca ccgtcttcgt gctgaccgtg gcggcgctga gcctgctgct ccaccgggtg       660
     gtgggcgtcc cgctgacccg gctgcgcacc gcctcggacc gcgtccggtc gggggccttc       720
     ggaacgcgga tcgagatcaa cgggccgtcc gacgtgcagg ccgtggcccg gacggtggag       780
     gacatgcggc ggcggctggc cgacgaactg tccgaggcgc agagccgcga ggccctgctc       840
     gcggagcaga cggacgagct gcggcgctcc aattcggagc tggagcagtt cgcgtacgtc       900
     gcctcgcacg acctccagga acctctgcgc aaggtcgcct ccttctgcca gctcctggag       960
     aagcggtacg gcaaggagct cgacgaccgg ggcaagcagt acatcgcctt cgcggtggac      1020
     ggcgccaagc ggatgcaggt cctcatcaac gacctgctga cgttctcgcg ggtgggccgg      1080
     gtgcaggagg gctggaagcc ggtcgatctg gaccggtccc tggaccgcgc cctgggcaac      1140
     ctggccgtcg cgatcgagga gtcggggacg gtgatcgagc ggccggagtc cctgcccgag      1200
     ctgctcgggg acgcgaccgc gctcaccatg gtctggcaga acctcgtcgg caacgcggtg      1260
     aagttccgcc gggagggcgt cccgtgccgg atctcggtca cctgcgtaca ggagggcgag      1320
     gactggcacc tcacggtgtc ggacaacggg atcgggatcg cgcccgagtt cgcggacaag      1380
     gtgttcgtca tcttccagcg gctgcacgcc cgtgacgagt acgacggcac cggcatcggc      1440
     ctcgcgctct gccggaagat catcgagttc cacggtggcc ggatctggct ggagcccgaa      1500
     ccgggcgaag gcacccgttt ccacttcacc ctgcccgtgg cgcccgaggc gcccacacac      1560
     accgcggcgg agctgctcgc tcccgccctg ctcaccagcc agccgggaga tccttcgtga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page