(data stored in ACNUC7421 zone)

EMBL: AP009493.PE737

AP009493.PE737       Location/Qualifiers
FT   CDS_pept        870686..871207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_737"
FT                   /product="putative regulatory protein containing a
FT                   conserved C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_737"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17566"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ8"
FT                   /protein_id="BAG17566.1"
FT                   /translation="MAEKVSDLTAAPWLEHMNEQVTSPPEDPGQGLAAAEVPPSAEVLM
FT                   SAEVFDGEPGCIAQARALADRFLTRLAVECLAPIGDHTRSDLMLAVSELVTNADRYSHG
FT                   PYLLELEGTAQLISVTVYDSSTAMPVLYAPDPSRLGGHGMEIVVALCDRLTAERVPVGK
FT                   RIRAEFQLSI"
     atggcggaaa aggtctccga cctcactgcg gcgccctggc tggagcacat gaacgaacag        60
     gtcacctccc caccggaaga cccgggtcag gggctggctg ccgccgaggt gcccccttcc       120
     gccgaggtac tgatgagcgc cgaggtcttc gacggcgagc cgggctgcat cgcccaggcc       180
     cgtgcgctcg ccgaccgctt cctgacgcgg ctcgcggtgg agtgcctcgc cccgatcggc       240
     gaccacacgc gcagcgacct gatgctggcc gtgagcgagc tggtcaccaa cgccgaccgc       300
     tacagccacg gcccctacct cttggagctg gagggcacgg ctcagctcat cagcgtcacg       360
     gtgtacgaca gcagcaccgc gatgcccgtg ctgtacgccc ccgatccgtc ccgcctcggc       420
     ggtcacggca tggagatcgt ggtggccctg tgcgaccggc tcacggccga gcgggtgccg       480
     gtgggcaagc ggatccgggc ggagttccag ctcagcatct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page