(data stored in ACNUC7421 zone)

EMBL: AP009493.PE77

AP009493.PE77        Location/Qualifiers
FT   CDS_pept        complement(79135..80763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_77t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_77t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16906"
FT                   /db_xref="GOA:B1VM05"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM05"
FT                   /protein_id="BAG16906.1"
FT                   /translation="MTPNRRPRSAPNDRELRLWKVGRALTLAFAAAVLVAGGVFYFLVV
FT                   LLDVQEIGATAKLDAKTLFDLVKLSFGVVAGAGALVALVVAYRRQRVDEAGAHREATRL
FT                   HTERFSQAVDKLGSDSPAVRLGGVHALAGLADDAPDNSLRQTCIDVLCAYLQLPFTPDP
FT                   GTDPAHQEEHHRYLAFRKVRHTILRLIGDHYRRPKGTHRSWQGCDLDLTGVTIDGDMDF
FT                   RGATFCGGTVSFSGATFSGSIVSFDDARFSGGTVSFSGATFSGGIVSFDDARFSGGTVS
FT                   FSGATFSGGIVSFDDARFSGGTVSFRHATFSGGDVSFDEAVFSGDVSFGGAMFSGGTVS
FT                   FGDATFSDGTVYFRSATFSGGTVSFRHATFSGGDVSFDEAVFSGDVSFGGAMFSGGTVS
FT                   FGDATFSDGTVSFRSATFSGGTVSFRHAMLSGGEVYFRSATFSGGTVYIDDAMFSGGEV
FT                   SFRSATFSSGTVYFRNATFSGGTVSFRGATFSGGTVSFRSATFSSGDLSFDGAIGSAPQ
FT                   GLLAAVGTPPPSGVTLPSAWLPSAP"
     atgacaccca atcgaaggcc ccgatccgcc ccgaatgacc gggagttaag gctgtggaag        60
     gtcggccggg cgctgaccct cgccttcgcc gccgcggtcc tggtcgcggg cggcgtcttc       120
     tacttcctgg tagtcctgct ggacgtccag gagatcggtg ccaccgcgaa gctcgacgcg       180
     aagacgctct tcgacctggt gaagctctcc ttcggagtgg tcgccggtgc cggtgcactc       240
     gtcgccctgg tcgtcgccta ccgccgccag cgcgtcgacg aagccggcgc tcaccgcgag       300
     gccacccggc tccacaccga gcgcttctcc caagccgtcg acaaactcgg ctccgactcc       360
     ccagccgtcc gactcggtgg cgtccacgca ctggcaggcc tcgccgacga cgcccccgac       420
     aacagccttc gccagacctg catcgacgtc ctgtgcgcct acctccagct ccctttcacc       480
     cccgaccccg gcaccgatcc tgcccatcag gaggaacacc accgctacct ggccttccgc       540
     aaggtgaggc acacgatcct gcgcctcatc ggcgaccact accgacgacc caagggaacc       600
     catcgctcct ggcagggctg cgatctggac ctcacaggtg tcaccatcga cggcgacatg       660
     gacttccgcg gcgcgacgtt ctgcggcggc accgtgtctt tcagcggcgc gacgttctcc       720
     ggcagcatcg tgtccttcga cgacgcgagg ttctccggcg gcaccgtgtc tttcagcggc       780
     gcgacgttct ccggcggcat cgtgtccttc gacgacgcga ggttctccgg cggcaccgtg       840
     tctttcagcg gcgcgacgtt ctccggcggc atcgtgtcct tcgacgacgc gaggttctcc       900
     ggcggcaccg tgtccttccg ccacgcgacg ttctccggcg gcgacgtgtc cttcgacgag       960
     gcggtgttct ccggcgacgt gtccttcggc ggcgcgatgt tctccggcgg caccgtgtcc      1020
     ttcggcgacg cgacgttctc cgacggcacg gtgtacttcc gcagcgcgac gttctccggc      1080
     ggcaccgtgt ccttccgcca cgcgacgttc tccggcggcg acgtgtcctt cgacgaggcg      1140
     gtgttctccg gcgacgtgtc cttcggcggc gcgatgttct ccggcggcac cgtgtccttc      1200
     ggcgacgcga cgttctccga cggcaccgtg tccttccgca gcgcgacgtt ctccggcggc      1260
     accgtgtcct tccgccacgc gatgctctcc ggcggtgagg tgtacttccg cagcgcgacg      1320
     ttctccggcg gcaccgtgta catcgacgac gcgatgttct ccggcggtga ggtgtccttc      1380
     cgcagcgcga cgttctccag tggcaccgtg tacttccgca acgcgacgtt ctctggcggc      1440
     accgtgtcct tccgcggcgc gacgttctcc ggcggcacgg tgtccttccg cagcgcgacg      1500
     ttctccagcg gcgacctgtc cttcgacggc gcgatcggtt cggctcctca ggggcttctt      1560
     gctgccgtgg gcacacctcc tccttcggga gttaccttgc cttcggcttg gctaccgtcg      1620
     gctccgtag                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page