(data stored in ACNUC7421 zone)

EMBL: AP009493.PE78

AP009493.PE78        Location/Qualifiers
FT   CDS_pept        complement(80760..81101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_78t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_78t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16907"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM06"
FT                   /protein_id="BAG16907.1"
FT                   /translation="MRYKAPGDRFPFSDRSFPALWQIFGGQGEAAAHEVDLDDPYGDLV
FT                   ALAHDLAGVVDGLVTVGSTSPSCPAVSASWARSSPGLIDAPPVYSSGFPPRHTGLAATA
FT                   DPPAVSSAS"
     gtgcggtaca aggcgcctgg agatcgcttc ccgttctcag acagatcgtt tcccgctctg        60
     tggcagatct ttggcggaca gggcgaggcg gcggcgcacg aggtcgacct cgacgatccg       120
     tacggtgatc ttgtcgccct cgctcacgat ctggccgggg tcgtcgacgg gctcgtcacg       180
     gtgggctcca cgtcaccgtc ctgcccggcg gtctcggcat cgtgggcgag gagttcgccc       240
     ggactgatcg atgcgcctcc cgtgtactcc agcggcttcc cgccccggca cactggactg       300
     gctgcaaccg ccgatcctcc agccgtatct tcagcgtcat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page