(data stored in ACNUC7421 zone)

EMBL: AP009493.PE8

AP009493.PE8         Location/Qualifiers
FT   CDS_pept        complement(7722..14138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_8t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_8t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16837"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK6"
FT                   /protein_id="BAG16837.1"
FT                   /translation="MSSTPFRRRVPGPGLRRWLGRGALVVTLSVFPQVAIPAEFSSLAQ
FT                   AQPSAQNKELEDRPDAKIDKVGRLKPGKSKAPNNKAAPAARETRERLKKAAWPKADKAT
FT                   AEVEASGGTETNVGGLGVKLAQQPVAPAGKQAKSTTKAKATGPAEKVALNVHSQAVAKK
FT                   AGINGVLLTVDPAGAASSKSADDTDTLRVSLDYSTFNDVYGGNFGPRLNLVALPACALT
FT                   TPKKKSCRTQTPVSGADNDAKSQTLTGTIPARSLKAGTPMVLAAAASSSGSGSDYSATP
FT                   LSPTATWEAGGSTGDFTWNYPLRVPPATAGPSPNLSILYNSASVDGRTAGENNQTSVIG
FT                   EGFALTESYIERKYGSCKDDGHSSKGDLCWKYANATLVLNGKAAELVNTCADKAACDAA
FT                   ALSEAAGGSWKLKNEDGTKVEHLTGATGNNDNNTEYWKVTDASGIQYFFGKHRLPGWSN
FT                   KGTTDTADDDPVTNSTWNVPVYGDDPGEPCYKSTGFADSSCMQTWRWNLDYVVDPHGNA
FT                   STYWYTKEANYYSKNADTTVNGTAYTRGGYLNRIDYGLRSELLYSKPAAQQVRFTYAER
FT                   CVTSGACTSLTEDTKADWPDVPYDMVCASGTKCTTQIGPAFFTRKRLTHITTSVWTGTG
FT                   TTRRDVDTWHLDQSFPNTGDASSPSLWLKSIQNTGKANDKAAAMPPVVFGGIQMPNHVE
FT                   GSGPDTLRYIKWRVRTIKSETGSTLTANYSNPDCIWGSSMPAAVDKNTRRCFPVKWSQS
FT                   GATPTTDWFHKYVVTSVFQEDPYGHGDTMETYYDYQGGAGWAYSDDEGLTKASNRTWSQ
FT                   WRGYGKVVTTSGDSEGPRSKNSALYMRGLNGEKELDGTARVEKVTDSTGTAIDDSRQYA
FT                   GFVRETIAYNNTAEVSGTISTPWSHKTGSHTYNWGTTDSWIVQAGESTSRTKTSTGTRT
FT                   TKQKTTYDTTYGMPLTMDDSGDTAKSGDETCRRTSYARNTSAWLVNRVSRVETYAVPCT
FT                   TAPTIPDDVVSDVATAYDNQEVGTAPSKGEITSSYRVANYGATDKKPIYQKVSGASYDK
FT                   LGRPLTKTNAQDQTLKTTYLPDDTGYGPLRSKTLTDPKLFTATTEVDPAWGTATKITNA
FT                   NGNVTEWSFDALGRLLSVWKPDRSRVGNDAASITYAYSINNEKETWVRTDTLKADGKTY
FT                   NSSYEIFDGLLRSRQVQTPAPNGGRVISETLYDDRGLAYMANSQIHDNNAPSGTLANTY
FT                   PGSTPASTETVYDEAGRATDSIFRVYNQEKWRTKTDKQGDRTAVTAAAGGSGTLTMVDA
FT                   RGRVTERREYAGPTPTGSDYTRTLYEYTAAGQLKKLSGPDGAVWTRSYDLRGREITSTD
FT                   PDKGSITSTYNDADQPVSATTTLNGVSRTVLTDYDELGRRIGTWDGTKDDAHRLTKFTY
FT                   DSLAKGQPTASIRYVGGTTGKIYSKSVTGYDVLGRAKGTKTVIAATDPLVTAGAPQSFT
FT                   TSTVYNMDGTVQSTSLPAAAGLPAETIENSYNGLGMLTGTDGMTDYVQSIGYSPYGEIE
FT                   ETRLGTSTGAKQMQILNRYEDGTRRLANSHTVDQTNTGYTSDVDYLYDATGNVKSMTDK
FT                   ANGKDTQCFAYDGYRRLTEAWTPSSNDCATARSSSALGGPAPYWTSWTYKVGGLRDTQT
FT                   EHKAAGDTKTSYGYPAVKADGTGQPHTLTSISVGAGTAKPFTYDERGNTTKRYGPTGSA
FT                   QTLVWDIEGKLTRLTEGTNTTDYLYDANGELLIRRGSGETVLYLAGQELHYDVNSKKFT
FT                   AKRYYTAGGATAVRTDAGLSWVVDDHHGTASMTVDATTQSVTRRYTKPFGENRGNAPTT
FT                   WPDDKGFLGKPADADTGLTHIGAREYDPITGRFLSVDPILVPEDHESLNGYAYSNNTPV
FT                   TLSDPTGLRPDGACGGSSSSCNGGTETWTKTSTGWDYNYQKEVTLPGTKTIMTSTVTYS
FT                   SGVTSTKVEFKPGPTPLPVLRAGAGPGFQLFSGGPAGVRLPGPLGFLGGLTRELDGSAI
FT                   REMAEELAEGRTDEDDDEFYYLYRAPHIGNKEAERHGPRPENHPPTKTKFRTEPGLAFL
FT                   GDTASVAEQYAGETQFEHGYWRYKMKPGFKKAFPAAKYRTPHENSRGAIEFEWIIPQAE
FT                   IPRFNSFIEGGSSKWTNYYSSGGYVYRD"
     gtgtcgtcaa cacctttccg cagacgcgtg ccagggccgg gcctacgccg ctggctcggc        60
     cgcggcgcac tcgtcgtcac cttgtctgtc tttccacaag tcgcgatacc cgcggaattc       120
     agctccctgg cccaggcgca gccctcggcc cagaacaagg agttggagga ccggcctgac       180
     gcgaagatcg acaaggtcgg tcgactcaag cccggaaagt ccaaggcccc gaacaacaag       240
     gctgctcctg ctgcccgtga aacgcgtgag cgcctgaaga aggccgcctg gccgaaagcc       300
     gacaaggcca ctgccgaggt ggaggcaagc ggcggcaccg agaccaacgt cggtggcctc       360
     ggcgtgaagc tggcccagca gcccgttgct ccggcaggta agcaggcgaa gagcaccacc       420
     aaggcgaagg ccacgggccc ggcagagaag gtggcgctca acgtccactc ccaggcggtg       480
     gcgaagaagg cgggtatcaa cggcgtcctg ctcaccgtcg acccggcggg agccgcatcc       540
     agcaagtccg ccgacgacac cgacacgctc cgcgtctccc tggactactc caccttcaac       600
     gacgtctacg gcggcaactt cggcccccga ctgaacctgg tagcactccc ggcgtgcgcg       660
     ctgaccactc cgaagaagaa gtcctgccgc acccagaccc ccgtatccgg cgcggacaac       720
     gacgccaagt cccagacact gactggcacg atccctgcac gcagcctcaa ggccggcacc       780
     cccatggtgc tggcagcagc agccagcagc tccggcagcg gaagcgacta cagcgccacc       840
     cccctgtccc cgaccgcgac ctgggaggcc ggcggcagca ccggtgactt cacctggaac       900
     taccccctgc gggttccccc ggcgacggcc ggcccgtccc cgaacctgtc catcctctac       960
     aactctgcct cggtggacgg ccgcacggcc ggcgagaaca accagacctc ggtgatcggc      1020
     gaaggcttcg ccctcaccga gtcctacatc gagcgtaagt acggctcctg caaggacgac      1080
     ggccattcca gcaagggcga cctgtgctgg aagtacgcca acgccactct tgtcctcaat      1140
     ggcaaggccg ccgaactcgt caacacttgc gcggacaagg cggcctgcga cgctgccgct      1200
     ctgtcggagg ccgccggcgg ctcgtggaag ctgaagaacg aagacggcac caaggtcgag      1260
     cacctcaccg gtgccactgg caacaacgac aacaacaccg agtactggaa ggtcaccgac      1320
     gcctccggca tccagtactt cttcggcaag caccgtctgc ccggctggag caacaagggc      1380
     accaccgaca ccgccgacga tgacccggtc accaactcca cctggaacgt cccggtctac      1440
     ggcgacgacc caggcgagcc ctgttacaag tccaccggct tcgccgactc ctcctgcatg      1500
     cagacttggc gctggaacct cgactatgtc gtcgacccgc acggtaacgc ctccacctac      1560
     tggtacacca aggaggcgaa ctactactcc aagaacgccg acaccaccgt caacggcacc      1620
     gcctataccc gcggcggcta cctcaaccgc atcgactacg gcctgcgcag cgagctgctc      1680
     tactccaagc ccgcagccca gcaggtccgc ttcacctacg cggaacgatg cgtcacctcc      1740
     ggcgcttgca ccagcctgac cgaggacacc aaggccgact ggcccgacgt cccgtacgac      1800
     atggtctgcg cgtcgggcac caagtgcacc acgcagatcg gcccggcctt cttcacccgc      1860
     aagcgcctta cccacatcac cacctcggtg tggaccggca ccggcaccac tcgtcgggac      1920
     gtcgacacat ggcaccttga ccagagcttc cccaacacgg gtgacgcctc gtcgccgagc      1980
     ctgtggctga agtccatcca gaacaccggc aaagccaacg acaaagcggc cgccatgccg      2040
     cccgtcgtct tcggcggcat ccagatgccc aaccacgtcg aaggcagcgg ccccgacacc      2100
     ctgcgctaca tcaaatggcg cgtacgcacc atcaagtccg aaaccggatc aaccctcacc      2160
     gctaactact cgaaccccga ctgcatttgg ggctcgagca tgccagcagc cgtcgacaag      2220
     aacacccgcc gctgcttccc ggtcaagtgg tcccagtccg gagcgacacc gaccaccgac      2280
     tggttccaca agtacgtcgt cacctccgtc ttccaagaag acccctacgg ccatggcgac      2340
     accatggaga cctactacga ctaccaaggc ggcgccggtt gggcgtactc cgacgacgag      2400
     ggcctgacca aggcgtcgaa tcgcacctgg tcgcagtggc gcggctacgg caaggtcgtc      2460
     acgacctccg gcgattccga aggcccacgc tccaagaatt ccgccctcta catgcgcggc      2520
     ctgaacggcg agaaggaact cgacggcacc gcacgcgtgg aaaaggtcac cgactccacc      2580
     ggcaccgcca tcgacgactc ccgccaatac gccggcttcg tccgcgaaac catcgcctac      2640
     aacaacaccg cagaagtcag cggcacgatc agcaccccct ggtcccacaa gaccggcagc      2700
     cacacctaca actggggcac cacggactcc tggatcgtcc aagccggcga atccaccagc      2760
     cgcacgaaga catccaccgg aacccgcacg accaagcaga agaccacgta cgacaccacg      2820
     tacggcatgc cactcacgat ggatgacagc ggggacaccg ccaaatccgg cgacgagacc      2880
     tgcaggcgca ccagctacgc ccgcaacaca tccgcctggc tggtgaacag agtctcgcgc      2940
     gttgagacgt acgcagtgcc gtgcacgacc gccccgacga tcccggatga cgtcgtctcg      3000
     gatgtggcca cggcctacga caatcaggag gttggaacag ccccgtcgaa gggcgaaatc      3060
     accagctcct accgtgtagc caactacggt gccacggaca agaaaccgat ctaccagaag      3120
     gtctccgggg cctcttacga caagctgggt cgcccactca ccaagaccaa cgcccaggac      3180
     cagacactca aaaccacata cctgcctgac gacacgggct atggcccgct gaggtctaag      3240
     acgctcaccg accccaagct cttcacggcc accaccgagg tagacccggc ctggggcact      3300
     gcaaccaaga tcacgaacgc caacggcaac gtcaccgagt ggtccttcga tgcactcggc      3360
     cggctgctgt cggtgtggaa accagaccgc tcccgcgtcg gcaacgacgc agccagcatc      3420
     acctacgcct acagcatcaa caacgagaag gagacctggg tccgcaccga caccctcaag      3480
     gctgacggga agacctacaa cagctcctac gagatcttcg acggcctgct gcgctctcgt      3540
     caggtacaga ctcccgcgcc gaacggcggc cgggtgatct ccgaaaccct ctacgacgac      3600
     cgcggcctgg cctacatggc caacagccag atccacgaca acaacgcccc gtcgggcacc      3660
     cttgccaaca cctaccctgg ctcgacgccc gcctccaccg agacggtcta cgacgaggcc      3720
     ggccgcgcca ccgactccat cttccgggtc tacaaccagg aaaagtggcg caccaagacc      3780
     gacaagcagg gcgaccgcac cgctgtcacc gccgctgcag ggggctccgg aacgctgacg      3840
     atggtcgacg cgcggggccg ggtcaccgaa cgccgtgaat acgcaggccc cactccgacc      3900
     ggcagtgact acacccggac gctgtatgag tacaccgcgg ccggtcagct taagaagctg      3960
     agcgggccgg atggggcggt ctggacccgc agctacgacc tgcgtggccg tgagatcacc      4020
     tccaccgacc ccgacaaggg atccatcacc tccacctaca acgacgcaga ccagccggtc      4080
     tccgctacca cgaccctcaa cggtgtctcc cgcaccgtgc tcaccgacta cgacgagctt      4140
     ggtcgccgga tcggcacctg ggacgggacc aaggacgacg cccaccggct gaccaagttc      4200
     acctacgact ccctggccaa gggacaaccc accgcgtcga tccggtacgt cggtggtacc      4260
     actggcaaga tctactccaa gtcggtcacc ggctacgacg tcctcggccg cgccaagggc      4320
     accaagaccg tcatcgccgc caccgacccg ctggtcactg caggcgcacc gcagtcattc      4380
     accacatcga ccgtctacaa catggacggc acagtccagt cgacttcact gccggcagca      4440
     gccgggctgc ctgccgagac catcgagaac agctacaacg gcctcggcat gctcaccggc      4500
     accgatggca tgaccgacta cgtgcagagc atcggctact ccccgtacgg tgagatcgag      4560
     gagacccgcc taggtacctc caccggtgcc aagcagatgc agatcctcaa ccgctacgag      4620
     gatggcaccc gacgcctggc caattcccac accgtcgacc agaccaacac cggctacacc      4680
     agtgacgtcg actacctcta cgacgccacc ggcaacgtca agtcgatgac ggacaaggcg      4740
     aacggcaagg acacccagtg cttcgcgtac gacggctacc gtcgcctgac cgaagcgtgg      4800
     accccgtcct ccaacgactg cgccaccgca cgctcgtcca gcgcactcgg cggcccggct      4860
     ccctactgga ccagctggac ctacaaagta gggggcctgc gcgacaccca gaccgagcac      4920
     aaggcagctg gtgacaccaa gacctcatac ggctaccccg ccgtcaaggc cgacggcacc      4980
     ggccagcccc acaccctgac ctcaatcagt gtgggcgccg gcaccgccaa gcccttcacc      5040
     tatgacgaga ggggaaacac caccaagcgc tacggcccca ccggaagtgc gcaaaccctc      5100
     gtctgggaca tcgaaggaaa gctcacccgc ctcaccgaag gcaccaacac cactgactac      5160
     ctctacgacg ccaacggtga actcctcatc cgccgcggct ctggcgagac cgtcctctac      5220
     ttggccgggc aggaactcca ctacgacgtg aacagcaaga agttcacggc taagcgctac      5280
     tacacggcgg ggggtgcgac cgcagtccgg accgatgccg gcctgtcctg ggtggtcgac      5340
     gaccaccatg gcaccgcatc gatgacagtc gacgccacca cccagtcggt cacccgccgc      5400
     tacacaaagc ccttcggaga gaaccgcggc aacgcgccga caacgtggcc cgacgacaag      5460
     gggttcctcg gaaaaccagc cgacgccgac accggactca cccacatcgg tgcccgcgag      5520
     tatgacccga tcaccggacg tttcctctcc gttgacccca ttctcgtgcc agaagaccac      5580
     gagtccctta acggctacgc ctattccaac aacacccccg tcaccctgtc cgatcccacc      5640
     ggactgcgcc ccgacggcgc gtgtggcggc tcatcgagct cctgcaacgg cggaaccgag      5700
     acctggacca agaccagtac aggctgggac tacaactacc aaaaggaagt cacgctcccg      5760
     ggcacaaaaa cgatcatgac cagcacggtc acctattcca gcggcgtgac gtcgacaaag      5820
     gttgaattca agccaggccc gacccctctg ccggtactga gagcgggagc cggcccgggt      5880
     tttcagctct ttagtggcgg tcctgcgggt gtccgacttc ctgggcccct ggggtttctt      5940
     ggcggtctta cccgtgagtt ggatggcagt gccattaggg agatggcaga ggaactcgct      6000
     gaaggccgca cagacgaaga tgatgatgag ttctattatc tgtatcgggc gccacacata      6060
     ggtaataaag aggcggaacg tcacggaccg cgaccggaga accatccgcc tacgaagacg      6120
     aagttcagga ccgaaccagg gctggctttt cttggcgata cggcgagtgt ggccgaacag      6180
     tacgcaggtg aaactcagtt cgagcacggc tactggcggt ataaaatgaa gccaggcttc      6240
     aagaaagcat ttcctgcggc gaagtaccgc actccccatg aaaacagcag aggggccatc      6300
     gaattcgaat ggataattcc gcaagcggaa atccctcgat tcaattcatt tattgagggc      6360
     gggagctcga aatggacgaa ctactatagt agtggtgggt acgtctaccg agactga         6417
//

If you have problems or comments...

PBIL Back to PBIL home page