(data stored in ACNUC7421 zone)

EMBL: AP009493.PE80

AP009493.PE80        Location/Qualifiers
FT   CDS_pept        83266..83700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_80t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_80t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16909"
FT                   /db_xref="GOA:B1VM08"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM08"
FT                   /protein_id="BAG16909.1"
FT                   /translation="MTRLLSALPGAPCPTLGATCPLAGWKQQFAMGERSGGRHRSVAVA
FT                   EELADRLRDADVGVETEHRHIDRPILPGVAGGLLSDHELAVLRLFARGRRQVEIAEDLR
FT                   ISPETVGRLLHRTRIVLRARTLAHAVALGGELGLLERPSS"
     gtgacacggc tcttatcggc actccctggc gctccgtgcc ccacgctggg cgctacgtgt        60
     ccgttggccg gttggaagca acaattcgca atgggcgaga ggagtggcgg ccggcaccgg       120
     tcggtggccg tggccgagga actcgccgac cggctgcgcg acgccgatgt cggcgtggag       180
     accgagcacc ggcacatcga ccggccgatc ctgcccggcg tggcaggagg gctgctgagc       240
     gatcacgaac tcgccgtgct ccgcctcttc gcccggggcc gcaggcaagt ggagatcgcc       300
     gaggacttga ggatcagtcc ggagacggtg gggcgcctgc tgcaccggac acggatcgtt       360
     ctccgggcac ggacgctcgc gcacgctgtc gctctcggcg gggagctcgg tcttctggaa       420
     cggccgagca gctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page